SitesBLAST
Comparing WP_085771168.1 NCBI__GCF_002117405.1:WP_085771168.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 12 hits to proteins with known functional sites (download)
P9WQ73 Phosphoserine aminotransferase; Phosphohydroxythreonine aminotransferase; PSAT; EC 2.6.1.52 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 2 papers)
26% identity, 95% coverage: 12:383/390 of query aligns to 17:375/376 of P9WQ73
- T154 (= T148) binding
- D176 (= D171) binding
- Q199 (= Q194) binding
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
2fyfA Structure of a putative phosphoserine aminotransferase from mycobacterium tuberculosis (see paper)
26% identity, 95% coverage: 12:383/390 of query aligns to 10:367/368 of 2fyfA
- active site: F101 (= F102), D168 (= D171), K192 (= K195)
- binding tetrachloroplatinate(ii): I321 (≠ V338), A324 (≠ E341)
- binding pyridoxal-5'-phosphate: A77 (≠ D77), T78 (= T78), W81 (≠ V81), F101 (= F102), T147 (= T148), D168 (= D171), T170 (= T173), Q191 (= Q194), K192 (= K195), N243 (= N248), T244 (= T249)
Sites not aligning to the query:
8a5wC Crystal structure of the human phosphoserine aminotransferase (psat) in complex with o-phosphoserine (see paper)
21% identity, 80% coverage: 6:318/390 of query aligns to 7:306/365 of 8a5wC
Sites not aligning to the query:
8a5wA Crystal structure of the human phosphoserine aminotransferase (psat) in complex with o-phosphoserine (see paper)
21% identity, 80% coverage: 6:318/390 of query aligns to 7:306/365 of 8a5wA
Sites not aligning to the query:
8a5vA Crystal structure of the human phosposerine aminotransferase (psat) (see paper)
21% identity, 80% coverage: 6:318/390 of query aligns to 7:306/365 of 8a5vA
Q9Y617 Phosphoserine aminotransferase; Phosphohydroxythreonine aminotransferase; PSAT; EC 2.6.1.52 from Homo sapiens (Human) (see 6 papers)
21% identity, 80% coverage: 6:318/390 of query aligns to 12:311/370 of Q9Y617
- S43 (= S41) to R: in PSATD; reduced O-phospho-L-serine:2-oxoglutarate aminotransferase catalytic efficiency; 3-fold increase of KM for 3-phosphohydroxypyruvate; 5-fold increase of KM for L-glutamate; decreased function in L-serine biosynthesis shown through in vitro reconstruction of the phosphorylated pathway; does not affect secondary structure; does not affect dimerization; does not affect thermal stability
- H44 (= H42) binding in other chain
- R45 (= R43) binding in other chain
- Y70 (= Y68) to N: in NLS2; uncertain significance
- G79 (≠ D77) binding ; to W: in NLS2; loss of O-phospho-L-serine:2-oxoglutarate aminotransferase activity; loss of function in L-serine biosynthesis shown through in vitro reconstruction of the phosphorylated pathway
- C80 (≠ T78) binding
- P87 (≠ E82) to A: has no effect on O-phospho-L-serine:2-oxoglutarate aminotransferase catalytic efficiency; does not affect KM for 3-phosphohydroxypyruvate; does not affect KM for L-glutamate; no effect on function in L-serine biosynthesis shown through in vitro reconstruction of the phosphorylated pathway; does not affect secondary structure; does not affect dimerization; does not affect thermal stability; dbSNP:rs11540974
- A99 (≠ V94) to V: in NLS2; does not affect secondary structure; does not affect dimerization; increased thermal stability; dbSNP:rs587777778
- D100 (= D95) to A: in PSATD; has no effect on O-phospho-L-serine:2-oxoglutarate aminotransferase catalytic efficiency; does not affect KM for 3-phosphohydroxypyruvate; does not affect KM for L-glutamate; does not affect secondary structure; results in increased protein aggregation as shown by dynamic light scattering; dbSNP:rs118203967
- W107 (≠ F102) binding
- E155 (≠ G147) to Q: in NLS2; uncertain significance
- T156 (= T148) binding
- D176 (= D171) binding
- S179 (= S174) to L: in NLS2; loss of O-phospho-L-serine:2-oxoglutarate aminotransferase activity; loss of function in L-serine biosynthesis shown through in vitro reconstruction of the phosphorylated pathway; dbSNP:rs587777777
- Q199 (= Q194) binding
- K200 (= K195) modified: N6-(pyridoxal phosphate)lysine
- N241 (= N248) binding in other chain
- T242 (= T249) binding in other chain
- C245 (≠ L252) to R: in NLS2; reduced O-phospho-L-serine:2-oxoglutarate aminotransferase catalytic efficiency; 9-fold increase of KM for L-glutamate; does not affect KM for 3-phosphohydroxypyruvate; decreased function in L-serine biosynthesis shown through in vitro reconstruction of the phosphorylated pathway; does not affect secondary structure; does not affect dimerization
Sites not aligning to the query:
- 335 binding
- 336 binding
- 342 binding ; R → W: in NLS2; loss of O-phospho-L-serine:2-oxoglutarate aminotransferase activity; loss of function in L-serine biosynthesis shown through in vitro reconstruction of the phosphorylated pathway; dbSNP:rs202103028
8a5vE Crystal structure of the human phosposerine aminotransferase (psat) (see paper)
21% identity, 80% coverage: 6:318/390 of query aligns to 8:307/366 of 8a5vE
Sites not aligning to the query:
3e77A Human phosphoserine aminotransferase in complex with plp
22% identity, 71% coverage: 36:310/390 of query aligns to 31:296/363 of 3e77A
- active site: W100 (≠ F102), D169 (= D171), K193 (= K195)
- binding pyridoxal-5'-phosphate: G71 (≠ S76), G72 (≠ D77), C73 (≠ T78), W100 (≠ F102), T149 (= T148), D169 (= D171), S171 (≠ T173), Q192 (= Q194), K193 (= K195), N234 (= N248), T235 (= T249)
8a5wE Crystal structure of the human phosphoserine aminotransferase (psat) in complex with o-phosphoserine (see paper)
20% identity, 80% coverage: 6:318/390 of query aligns to 8:306/365 of 8a5wE
- binding (2S)-2-[(E)-[2-methyl-3-oxidanyl-5-(phosphonooxymethyl)pyridin-4-yl]methylideneamino]-3-phosphonooxy-propanoic acid: H40 (= H42), R41 (= R43), N236 (= N248), T237 (= T249)
- binding (2~{S})-2-[[(~{R})-[[(5~{S})-5-azanyl-6-oxidanylidene-hexyl]amino]-[2-methyl-3-oxidanyl-5-(phosphonooxymethyl)pyridin-4-yl]methyl]amino]-3-phosphonooxy-propanoic acid: G74 (≠ S76), G75 (≠ D77), C76 (≠ T78), W103 (≠ F102), T152 (= T148), S174 (≠ T173), A194 (≠ W193), Q195 (= Q194), N196 (≠ K195)
Sites not aligning to the query:
1w23B Crystal structure of phosphoserine aminotransferase from bacillus alcalophilus (see paper)
21% identity, 80% coverage: 8:319/390 of query aligns to 11:305/357 of 1w23B
- active site: W102 (= W106), D172 (= D171), K196 (= K195)
- binding magnesium ion: Y127 (= Y126), Y154 (≠ S150), H285 (≠ A299), A286 (≠ K300)
- binding pyridoxal-5'-phosphate: A76 (≠ D77), S77 (≠ T78), W102 (= W106), T152 (= T148), D172 (= D171), S174 (≠ T173), Q195 (= Q194), K196 (= K195), N234 (= N248), T235 (= T249)
4azjA Structural basis of l-phosphoserine binding to bacillus alcalophilus phosphoserine aminotransferase (see paper)
20% identity, 80% coverage: 8:319/390 of query aligns to 11:308/360 of 4azjA
- active site: W102 (= W106), D172 (= D171), K196 (= K195)
- binding pyridoxal-5'-phosphate: A76 (≠ D77), S77 (≠ T78), W102 (= W106), T152 (= T148), D172 (= D171), S174 (≠ T173), Q195 (= Q194), K196 (= K195), N237 (= N248), T238 (= T249)
- binding phosphoserine: H41 (= H42), R42 (= R43), W102 (= W106), T152 (= T148), K196 (= K195)
Sites not aligning to the query:
3ffrA Crystal structure of a phosphoserine aminotransferase serc (chu_0995) from cytophaga hutchinsonii atcc 33406 at 1.75 a resolution
23% identity, 76% coverage: 17:311/390 of query aligns to 7:303/361 of 3ffrA
Sites not aligning to the query:
Query Sequence
>WP_085771168.1 NCBI__GCF_002117405.1:WP_085771168.1
MSFSHPKPAGLPKNPSFSSGPCAKRPGWSPQNLSAAALGRSHRAKAGKEKLERAIALTRE
VLRVPDDYRIGIVPASDTGAVEMALWSMLGPRPVDVLAFESFSSGWATDVQKQLKLPQAR
VLTAPYGELPDLAQVNGDHDLVFAWNGTTSGVRVPNAAFIAADRKGLTICDATSGAFAQP
LDFAKLDVTTFSWQKCLGGEAAHGMLILSPRAVERLESYVPPWPLPKIFRLTKGSKLIEG
VFAGETINTPSLLCVEDYLDALQWARSIGGLDALCARADANAAVVAEWTLRQPAFAFLAK
QPQTRSNTSVCLEFADPRVIAMDPKARSGLAKALVSLVEKEGAGFDFGAYRDAPPGLRIW
CGPTVEPADVSLLTDWIDWAFEQALAILPA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory