Comparing WP_085772643.1 NCBI__GCF_002117405.1:WP_085772643.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 3 hits to proteins with known functional sites (download)
P39912 Protein AroA(G); EC 2.5.1.54; EC 5.4.99.5 from Bacillus subtilis (strain 168) (see paper)
31% identity, 26% coverage: 9:82/286 of query aligns to 6:78/358 of P39912
Sites not aligning to the query:
5gmuB Crystal structure of chorismate mutase like domain of bifunctional dahp synthase of bacillus subtilis in complex with chlorogenic acid (see paper)
31% identity, 26% coverage: 9:82/286 of query aligns to 5:77/87 of 5gmuB
Sites not aligning to the query:
5j6fA Crystal structure of dah7ps-cm complex from geobacillus sp. With prephenate (see paper)
30% identity, 27% coverage: 7:82/286 of query aligns to 2:76/352 of 5j6fA
Sites not aligning to the query:
>WP_085772643.1 NCBI__GCF_002117405.1:WP_085772643.1
MPPSPADALSELRQEIDRIDLSMHRLLMERGEIIHRLIEVKRAQGAGCAFRPDREAQMMR
ALVERHQGLLPLDAVEGIWRVIVSTFTYVQAPYTVHADDSGGDAQMRDSARFHFGFTVPY
APHHGALAVISAVAASGGDLGVLRASGGSGDGAWWLRLIGDAGPKIIARLPFVERPDHPA
GLPVFVIAKPGAEAASQDIALFSISLPRWTHDAPAAVAAAEGEILAAAPVPGGHSILVAL
PAAQATRLPAALGDANLGAAQIDPVGGHSARFEMDEARAGVFAPEP
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory