SitesBLAST
Comparing WP_085773091.1 NCBI__GCF_002117405.1:WP_085773091.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
8sabA Crystal structure of cystathionine beta lyase from klebsiella aerogenes, plp adduct with alanine (c2 form)
41% identity, 95% coverage: 12:391/398 of query aligns to 1:391/392 of 8sabA
- binding lysine: N9 (≠ H20), R12 (= R23), R13 (≠ H24), K14 (≠ P25), T17 (≠ Q28), L330 (= L333), E341 (= E344)
- binding pyridoxal-5'-phosphate: C82 (≠ S88), G83 (= G89), A84 (≠ L90), Y108 (= Y114), D182 (= D186), A204 (= A208), T206 (= T210), K207 (= K211), M216 (≠ L220), W337 (= W340)
- binding alanyl-pyridoxal-5'-phosphate: C82 (≠ S88), G83 (= G89), A84 (≠ L90), Y108 (= Y114), D182 (= D186), A204 (= A208), T206 (= T210), K207 (= K211), M216 (≠ L220), Y335 (= Y338), S336 (= S339), W337 (= W340), R369 (= R369)
8sadA Crystal structure of cystathionine beta lyase from klebsiella aerogenes, plp/malonate complex (c2 form)
41% identity, 95% coverage: 12:391/398 of query aligns to 7:397/398 of 8sadA
- binding magnesium ion: A359 (= A353), R362 (= R356), A365 (≠ T359)
- binding pyridoxal-5'-phosphate: C88 (≠ S88), G89 (= G89), A90 (≠ L90), Y114 (= Y114), D188 (= D186), A210 (= A208), T212 (= T210), K213 (= K211), M222 (≠ L220), W343 (= W340)
8u99A Crystal structure of cystathionine beta lyase from klebsiella aerogenes (plp-serine adduct)
41% identity, 94% coverage: 16:391/398 of query aligns to 4:390/391 of 8u99A
- binding pyridoxal-5'-phosphate: C81 (≠ S88), G82 (= G89), A83 (≠ L90), Y107 (= Y114), D181 (= D186), T205 (= T210), K206 (= K211), M215 (≠ L220), W336 (= W340)
- binding serine: Y107 (= Y114), K206 (= K211), Y334 (= Y338), S335 (= S339), W336 (= W340), R368 (= R369)
8u98A Crystal structure of cystathionine beta lyase from klebsiella aerogenes (plp-glycine adduct)
41% identity, 94% coverage: 16:391/398 of query aligns to 4:390/391 of 8u98A
- binding glycine: Y107 (= Y114), K206 (= K211), Y334 (= Y338), S335 (= S339), W336 (= W340), R368 (= R369)
- binding pyridoxal-5'-phosphate: Y52 (= Y59), R54 (≠ T61), C81 (≠ S88), G82 (= G89), A83 (≠ L90), Y107 (= Y114), D181 (= D186), A203 (= A208), T205 (= T210), K206 (= K211), M215 (≠ L220), W336 (= W340)
8sa9A Crystal structure of cystathionine beta lyase from klebsiella aerogenes, plp-oxamate adduct (c2 form)
41% identity, 94% coverage: 16:391/398 of query aligns to 4:390/391 of 8sa9A
- binding pyridoxal-5'-phosphate: C81 (≠ S88), G82 (= G89), A83 (≠ L90), Y107 (= Y114), D181 (= D186), A203 (= A208), T205 (= T210), K206 (= K211), M215 (≠ L220), W336 (= W340)
- binding [({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)amino](oxo)acetic acid: C81 (≠ S88), G82 (= G89), A83 (≠ L90), Y107 (= Y114), D181 (= D186), A203 (= A208), T205 (= T210), K206 (= K211), M215 (≠ L220), S335 (= S339), W336 (= W340), R368 (= R369)
1cl1B Cystathionine beta-lyase (cbl) from escherichia coli (see paper)
39% identity, 95% coverage: 12:391/398 of query aligns to 1:391/392 of 1cl1B
P06721 Cystathionine beta-lyase MetC; CBL; CL; Beta-cystathionase MetC; Cysteine desulfhydrase MetC; CD; Cysteine lyase MetC; Cysteine-S-conjugate beta-lyase MetC; EC 4.4.1.13; EC 4.4.1.28 from Escherichia coli (strain K12) (see 2 papers)
39% identity, 95% coverage: 12:391/398 of query aligns to 4:394/395 of P06721
- K210 (= K211) modified: N6-(pyridoxal phosphate)lysine
2gqnA Cystathionine beta-lyase (cbl) from escherichia coli in complex with n-hydrazinocarbonylmethyl-2-nitro-benzamide (see paper)
39% identity, 94% coverage: 16:391/398 of query aligns to 4:390/391 of 2gqnA
- active site: R54 (≠ T61), Y107 (= Y114), D181 (= D186), K206 (= K211)
- binding (5-hydroxy-6-methyl-4-((2-(2-(2-nitrobenzamido)acetyl)hydrazinyl)methyl)pyridin-3-yl)methyl dihydrogen phosphate: C81 (≠ S88), G82 (= G89), A83 (≠ L90), Y107 (= Y114), E108 (≠ G115), D181 (= D186), A203 (= A208), T205 (= T210), K206 (= K211), M215 (≠ L220), Y334 (= Y338), S335 (= S339), W336 (= W340), R368 (= R369)
2fq6A Cystathionine beta-lyase (cbl) from escherichia coli in complex with n-hydrazinocarbonylmethyl-2-trifluoromethyl-benzamide (see paper)
39% identity, 94% coverage: 16:391/398 of query aligns to 4:390/391 of 2fq6A
- active site: R54 (≠ T61), Y107 (= Y114), D181 (= D186), K206 (= K211)
- binding phosphoric acid mono-(5-hydroxy-6-methyl-4-{[2-(2-trifluoromethyl-benzoylamino)-acetyl]-hydrazonomethyl}-pyridin-3-ylmethyl)ester: C81 (≠ S88), G82 (= G89), A83 (≠ L90), Y107 (= Y114), P109 (= P116), D181 (= D186), A203 (= A208), T205 (= T210), K206 (= K211), M215 (≠ L220), Y334 (= Y338), S335 (= S339), W336 (= W340), R368 (= R369)
1cl2A Cystathionine beta-lyase (cbl) from escherichia coli in complex with aminoethoxyvinylglycine (see paper)
39% identity, 94% coverage: 16:391/398 of query aligns to 4:390/391 of 1cl2A
- active site: R54 (≠ T61), Y107 (= Y114), D181 (= D186), K206 (= K211)
- binding (2E,3E)-4-(2-aminoethoxy)-2-[({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)imino]but-3-enoic acid: C81 (≠ S88), G82 (= G89), A83 (≠ L90), Y107 (= Y114), D181 (= D186), A203 (= A208), T205 (= T210), K206 (= K211), M215 (≠ L220), Y334 (= Y338), S335 (= S339), W336 (= W340), R368 (= R369)
4itxA P113s mutant of e. Coli cystathionine beta-lyase metc inhibited by reaction with l-ala-p (see paper)
39% identity, 94% coverage: 16:391/398 of query aligns to 4:390/391 of 4itxA
- active site: R54 (≠ T61), Y107 (= Y114), D181 (= D186), K206 (= K211)
- binding {1-[(3-hydroxy-methyl-5-phosphonooxy-methyl-pyridin-4-ylmethyl)-amino]-ethyl}-phosphonic acid: C81 (≠ S88), G82 (= G89), A83 (≠ L90), Y107 (= Y114), D181 (= D186), A203 (= A208), T205 (= T210), K206 (= K211), M215 (≠ L220), Y334 (= Y338), S335 (= S339), W336 (= W340), R368 (= R369)
4l0oH Structure determination of cystathionine gamma-synthase from helicobacter pylori
33% identity, 95% coverage: 15:391/398 of query aligns to 4:373/373 of 4l0oH
- active site: R40 (≠ T61), Y92 (= Y114), D164 (= D186), K189 (= K211)
- binding pyridoxal-5'-phosphate: Y38 (= Y59), R40 (≠ T61), S67 (= S88), G68 (= G89), L69 (= L90), Y92 (= Y114), D164 (= D186), S186 (≠ A208), T188 (= T210), K189 (= K211)
P55217 Cystathionine gamma-synthase 1, chloroplastic; AtCGS1; METHIONINE OVERACCUMULATION 1; O-succinylhomoserine (thiol)-lyase; EC 2.5.1.48 from Arabidopsis thaliana (Mouse-ear cress) (see 4 papers)
33% identity, 90% coverage: 32:389/398 of query aligns to 195:561/563 of P55217
- T412 (≠ V244) natural variant: T -> P
- G459 (≠ A291) natural variant: G -> A
Sites not aligning to the query:
- 8 natural variant: C -> S
- 55 natural variant: A -> G
- 77 R→H: In mto1-4; over-accumulation of soluble methionine.
- 78 R→K: In mto1-7; over-accumulation of soluble methionine.
- 81 S→N: In mto1-2; over-accumulation of soluble methionine.
- 84 G→D: In mto1-3 and mto1-5; over-accumulation of soluble methionine.; G→S: In mto1-1; over-accumulation of soluble methionine.
- 86 A→V: In mto1-6; over-accumulation of soluble methionine.
- 91 natural variant: A -> G
6egrA Crystal structure of citrobacter freundii methionine gamma-lyase with v358y replacement (see paper)
29% identity, 96% coverage: 10:390/398 of query aligns to 4:394/396 of 6egrA
1qgnA Cystathionine gamma-synthase from nicotiana tabacum (see paper)
32% identity, 90% coverage: 32:391/398 of query aligns to 30:398/398 of 1qgnA
- active site: R63 (≠ T61), Y116 (= Y114), D189 (= D186), K214 (= K211)
- binding pyridoxal-5'-phosphate: Y61 (= Y59), R63 (≠ T61), S90 (= S88), G91 (= G89), M92 (≠ L90), Y116 (= Y114), D189 (= D186), S211 (≠ A208), T213 (= T210), K214 (= K211), F342 (≠ W340)
1i48A Cystathionine gamma-synthase in complex with the inhibitor ctcpo (see paper)
32% identity, 90% coverage: 32:391/398 of query aligns to 28:396/396 of 1i48A
- active site: R61 (≠ T61), Y114 (= Y114), D187 (= D186), K212 (= K211)
- binding carboxymethylthio-3-(3-chlorophenyl)-1,2,4-oxadiazol: Y114 (= Y114), R115 (≠ G115), A337 (≠ G337), P338 (≠ Y338), S339 (= S339), D348 (≠ I348), S354 (vs. gap), R374 (= R369), S376 (= S371)
- binding pyridoxal-5'-phosphate: Y59 (= Y59), R61 (≠ T61), S88 (= S88), G89 (= G89), M90 (≠ L90), Y114 (= Y114), D187 (= D186), S209 (≠ A208), T211 (= T210), K212 (= K211), F340 (≠ W340)
1i43A Cystathionine gamma-synthase in complex with the inhibitor ppca (see paper)
32% identity, 90% coverage: 32:391/398 of query aligns to 28:396/396 of 1i43A
- active site: R61 (≠ T61), Y114 (= Y114), D187 (= D186), K212 (= K211)
- binding pyridoxal-5'-phosphate: Y59 (= Y59), R61 (≠ T61), S88 (= S88), G89 (= G89), M90 (≠ L90), Y114 (= Y114), D187 (= D186), S209 (≠ A208), T211 (= T210), K212 (= K211), F340 (≠ W340)
- binding 3-(phosphonomethyl)pyridine-2-carboxylic acid: E58 (≠ T58), Y62 (≠ K62), Y114 (= Y114), K212 (= K211), P338 (≠ Y338), S354 (vs. gap), R374 (= R369)
1i41A Cystathionine gamma-synthase in complex with the inhibitor appa (see paper)
32% identity, 90% coverage: 32:391/398 of query aligns to 28:396/396 of 1i41A
- active site: R61 (≠ T61), Y114 (= Y114), D187 (= D186), K212 (= K211)
- binding 2-[(3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridin-4-ylmethyl)-imino]-5-phosphono-pent-3-enoic acid: E58 (≠ T58), Y59 (= Y59), R61 (≠ T61), Y62 (≠ K62), G89 (= G89), M90 (≠ L90), Y114 (= Y114), E158 (= E157), D187 (= D186), T189 (= T188), S209 (≠ A208), T211 (= T210), K212 (= K211), P338 (≠ Y338), S339 (= S339), R374 (= R369)
7d7oB Crystal structure of cystathionine gamma-lyase from bacillus cereus atcc 14579 (see paper)
33% identity, 94% coverage: 15:388/398 of query aligns to 4:376/377 of 7d7oB
5m3zA Crystal structure of citrobacter freundii methionine gamma-lyase with c115h replacement in the complex with l-norleucine (see paper)
29% identity, 96% coverage: 10:390/398 of query aligns to 3:393/395 of 5m3zA
- active site: R58 (≠ T61), Y111 (= Y114), D183 (= D186), K208 (= K211)
- binding norleucine: Y111 (= Y114), H113 (≠ P116), K208 (= K211), V336 (≠ Y338), S337 (= S339)
- binding pyridoxal-5'-phosphate: G86 (= G89), I87 (≠ L90), Y111 (= Y114), E154 (= E157), D183 (= D186), T185 (= T188), S205 (≠ A208), T207 (= T210), K208 (= K211)
- binding 2-[o-phosphonopyridoxyl]-amino-hexanoic acid: G86 (= G89), I87 (≠ L90), Y111 (= Y114), D183 (= D186), S205 (≠ A208), T207 (= T210), K208 (= K211), V336 (≠ Y338), S337 (= S339), R372 (= R369)
Query Sequence
>WP_085773091.1 NCBI__GCF_002117405.1:WP_085773091.1
MTEASGESGRKKSRRTLLAHAGRHPFAQEGFVNTPVYRGSTVLFPTAEDFERHRQPYTYA
TKGTPTTRGLEEAWSELSGATTTVLAPSGLAAIALALMTATKAGDHLLVTDSAYGPTRIF
CDGVLKRFGVETQYYDPRLGAGVGALMRENTSAILAESPGSLTMEVQDVPAIAAAAAARG
ACVILDNTWATPLFFPPFERGVDINVEAGTKYLSGHADLLLGLVSANAKWATRLRNSFDA
FAMVPGGDDAFLALRGLRTMELRLREQQRAGLEIAQWLEGRSEVLRLLHPALPAHPDHAL
WKRDFSGAAGVFSVVLNPAPKPCVDAFLNALTLFGIGYSWGGYESLVIPFDCARSRTATC
FAPEGPCLRFSIGLEDVEDLKADLAAAFERMGAAAASL
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory