SitesBLAST
Comparing WP_085984982.1 NCBI__GCF_000022085.1:WP_085984982.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2zsjA Crystal structure of threonine synthase from aquifex aeolicus vf5
32% identity, 99% coverage: 3:309/309 of query aligns to 26:332/350 of 2zsjA
- active site: K61 (= K32), T85 (≠ S56), Q218 (= Q188), A222 (≠ C192), A240 (≠ G218), T317 (= T294)
- binding pyridoxal-5'-phosphate: F60 (= F31), K61 (= K32), N87 (= N58), V186 (= V156), G187 (= G157), N188 (≠ A158), A189 (≠ G159), G190 (≠ S160), N191 (≠ S161), A240 (≠ G218), T317 (= T294), G318 (= G295)
1uimA Crystal structure of threonine synthase from thermus thermophilus hb8, orthorhombic crystal form (see paper)
33% identity, 99% coverage: 3:309/309 of query aligns to 26:332/350 of 1uimA
- active site: K61 (= K32), T85 (≠ S56), P212 (= P182), G216 (≠ S198), Q218 (= Q200), A240 (≠ G218), T317 (= T294)
- binding pyridoxal-5'-phosphate: F60 (= F31), K61 (= K32), N87 (= N58), G187 (= G157), N188 (≠ A158), A189 (≠ G159), G190 (≠ S160), N191 (≠ S161), A240 (≠ G218), E287 (= E264), T317 (= T294), G318 (= G295)
3aexA Catalytic intermediate analogue of threonine synthase from thermus thermophilus hb8 (see paper)
33% identity, 99% coverage: 3:309/309 of query aligns to 26:332/351 of 3aexA
- active site: K61 (= K32), T85 (≠ S56), P212 (= P182), G216 (≠ S198), Q218 (= Q200), A240 (≠ G218), T317 (= T294)
- binding (3E)-4-{3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}-2-oxobut-3-enoic acid: K61 (= K32), S84 (= S55), T85 (≠ S56), N87 (= N58), T88 (≠ G59), V186 (= V156), G187 (= G157), N188 (≠ A158), A189 (≠ G159), G190 (≠ S160), N191 (≠ S161), A240 (≠ G218), I241 (≠ T219), E287 (= E264), T317 (= T294)
- binding phosphate ion: K61 (= K32), T88 (≠ G59), N154 (≠ H123), S155 (≠ N124), R160 (≠ F129), N188 (≠ A158)
1v7cA Crystal structure of threonine synthase from thermus thermophilus hb8 in complex with a substrate analogue (see paper)
33% identity, 99% coverage: 3:309/309 of query aligns to 26:332/351 of 1v7cA
- active site: K61 (= K32), T85 (≠ S56), P212 (= P182), G216 (≠ S198), Q218 (= Q200), A240 (≠ G218), T317 (= T294)
- binding (2e)-2-[({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)amino]-5-phosphonopent-2-enoic acid: K61 (= K32), S84 (= S55), T85 (≠ S56), N87 (= N58), T88 (≠ G59), F134 (≠ R104), N154 (≠ H123), S155 (≠ N124), R160 (≠ F129), V186 (= V156), G187 (= G157), N188 (≠ A158), A189 (≠ G159), G190 (≠ S160), N191 (≠ S161), A240 (≠ G218), I241 (≠ T219), E287 (= E264), T317 (= T294)
3aeyA Apo form of threonine synthase from thermus thermophilus hb8 (see paper)
33% identity, 99% coverage: 3:309/309 of query aligns to 25:331/350 of 3aeyA
- active site: K60 (= K32), T84 (≠ S56), P211 (= P182), G215 (≠ S198), Q217 (= Q200), A239 (≠ G218), T316 (= T294)
- binding sulfate ion: K60 (= K32), K60 (= K32), G85 (= G57), N86 (= N58), T87 (≠ G59), T87 (≠ G59), S154 (≠ N124), R159 (≠ F129), N187 (≠ A158), R228 (= R209), V230 (= V211), E231 (≠ H212), R232 (≠ K213), A239 (≠ G218)
6cgqA Threonine synthase from bacillus subtilis atcc 6633 with plp and plp- ala (see paper)
30% identity, 99% coverage: 1:307/309 of query aligns to 21:318/339 of 6cgqA
- active site: K56 (= K32), T80 (≠ S56), E206 (≠ D196), S210 (≠ Q200), A228 (≠ G218), T305 (= T294)
- binding pyridoxal-5'-phosphate: F55 (= F31), K56 (= K32), N82 (= N58), V175 (= V156), G176 (= G157), N177 (≠ A158), A178 (≠ G159), G179 (≠ S160), N180 (≠ S161), A228 (≠ G218), E275 (= E264), T305 (= T294), G306 (= G295)
6nmxA Threonine synthase from bacillus subtilis atcc 6633 with plp and appa (see paper)
30% identity, 99% coverage: 1:307/309 of query aligns to 25:328/350 of 6nmxA
- active site: K60 (= K32), T84 (≠ S56), E216 (≠ D196), S220 (≠ Q200), A238 (≠ G218), T315 (= T294)
- binding (2E,3Z)-2-{[(Z)-{3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4(1H)-ylidene}methyl]imino}-5-phosphonopent-3-enoic acid: K60 (= K32), S83 (= S55), T84 (≠ S56), N86 (= N58), T87 (≠ G59), F133 (≠ R104), N153 (≠ H123), S154 (≠ N124), R159 (≠ F129), V185 (= V156), G186 (= G157), N187 (≠ A158), A188 (≠ G159), G189 (≠ S160), N190 (≠ S161), A238 (≠ G218), I239 (≠ T219), E285 (= E264), T315 (= T294)
6cgqB Threonine synthase from bacillus subtilis atcc 6633 with plp and plp- ala (see paper)
30% identity, 99% coverage: 1:307/309 of query aligns to 23:326/345 of 6cgqB
- active site: K58 (= K32), T82 (≠ S56), E214 (≠ D196), S218 (≠ Q200), A236 (≠ G218), T313 (= T294)
- binding (E)-N-({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene)-L-alanine: K58 (= K32), S81 (= S55), T82 (≠ S56), N84 (= N58), T85 (≠ G59), V183 (= V156), G184 (= G157), N185 (≠ A158), A186 (≠ G159), N188 (≠ S161), A236 (≠ G218), I237 (≠ T219), E283 (= E264), T313 (= T294)
- binding phosphate ion: K58 (= K32), T85 (≠ G59), N151 (≠ H123), S152 (≠ N124), R157 (≠ F129), N185 (≠ A158)
A0R220 Threonine synthase; TS; EC 4.2.3.1 from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see paper)
32% identity, 97% coverage: 3:303/309 of query aligns to 36:335/360 of A0R220
- K151 (≠ R113) modified: Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-Cter in protein Pup)
P9WG59 Threonine synthase; TS; EC 4.2.3.1 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 2 papers)
31% identity, 92% coverage: 19:303/309 of query aligns to 56:335/360 of P9WG59
- K69 (= K32) modified: N6-(pyridoxal phosphate)lysine
- N95 (= N58) binding
- K151 (≠ R113) modified: Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-Cter in protein Pup)
- GNAGN 196:200 (≠ GAGSS 157:161) binding
- T326 (= T294) binding
2d1fA Structure of mycobacterium tuberculosis threonine synthase (see paper)
31% identity, 92% coverage: 19:303/309 of query aligns to 47:326/349 of 2d1fA
- active site: K60 (= K32), T84 (≠ S56), D209 (≠ T179), R213 (= R183), L215 (≠ F185), A240 (≠ G218), T317 (= T294)
- binding pyridoxal-5'-phosphate: F59 (= F31), K60 (= K32), N86 (= N58), V186 (= V156), G187 (= G157), N188 (≠ A158), A189 (≠ G159), G190 (≠ S160), N191 (≠ S161), A240 (≠ G218), T317 (= T294)
2c2bA Crystallographic structure of arabidopsis thaliana threonine synthase complexed with pyridoxal phosphate and s-adenosylmethionine (see paper)
28% identity, 90% coverage: 28:306/309 of query aligns to 124:409/444 of 2c2bA
- binding pyridoxal-5'-phosphate: F127 (= F31), K128 (= K32), D159 (≠ N58), G259 (≠ V156), G260 (= G157), N261 (≠ A158), L262 (≠ G159), G263 (≠ S160), N264 (≠ S161), A321 (≠ G218), H369 (≠ T266), T397 (= T294)
- binding s-adenosylmethionine: Q246 (≠ D143), F247 (= F144)
Sites not aligning to the query:
- binding s-adenosylmethionine: 64, 65, 66, 67, 69, 90, 92, 97, 98, 100, 115, 115
Q9S7B5 Threonine synthase 1, chloroplastic; Protein METHIONINE OVER-ACCUMULATOR 2; EC 4.2.3.1 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
28% identity, 90% coverage: 28:306/309 of query aligns to 199:484/526 of Q9S7B5
- L205 (≠ R34) mutation to R: In mto2-1; causes a strong decrease in the concentration of soluble threonine and over-accumulation of methionine.
Sites not aligning to the query:
- 172 binding
- 173 binding
- 181 binding in monomer B; binding in monomer A
- 187 binding in monomer B
2c2gA Crystal structure of threonine synthase from arabidopsis thaliana in complex with its cofactor pyridoxal phosphate (see paper)
26% identity, 90% coverage: 28:306/309 of query aligns to 142:411/448 of 2c2gA
6zspAAA serine racemase bound to atp and malonate. (see paper)
29% identity, 83% coverage: 19:274/309 of query aligns to 40:283/320 of 6zspAAA
- active site: K53 (= K32), S74 (= S56), E200 (≠ Q188), A204 (≠ C192), D206 (≠ A197), G229 (= G218)
- binding adenosine-5'-triphosphate: K48 (≠ P27), T49 (= T28), Q79 (≠ S61), Y111 (= Y93), E266 (≠ A257), R267 (= R258), K269 (≠ G260)
- binding magnesium ion: E200 (≠ Q188), A204 (≠ C192), D206 (≠ A197)
- binding malonate ion: K53 (= K32), S73 (= S55), S74 (= S56), N76 (= N58), H77 (≠ G59), R125 (≠ S107), G229 (= G218), S232 (≠ I221)
Sites not aligning to the query:
7nbgAAA structure of human serine racemase in complex with DSiP fragment Z52314092, XChem fragment screen (see paper)
29% identity, 83% coverage: 19:274/309 of query aligns to 40:290/322 of 7nbgAAA
- active site: K53 (= K32), S81 (= S56), E207 (≠ Q188), A211 (≠ C192), D213 (≠ A197), G236 (= G218)
- binding calcium ion: E207 (≠ Q188), A211 (≠ C192), D213 (≠ A197)
- binding pyridoxal-5'-phosphate: F52 (= F31), K53 (= K32), N83 (= N58), G182 (= G157), G183 (≠ A158), G184 (= G159), G185 (≠ S160), M186 (≠ S161), G236 (= G218), V237 (≠ T219), T282 (= T266)
- binding ~{N}-[2-(2-methylphenyl)ethyl]ethanamide: S81 (= S56), G85 (= G60), Q86 (≠ S61), I101 (= I76), K111 (= K86), I115 (≠ V90), Y118 (= Y93)
Sites not aligning to the query:
7nbfAAA structure of human serine racemase in complex with DSiP fragment Z126932614, XChem fragment screen (see paper)
29% identity, 83% coverage: 19:274/309 of query aligns to 40:290/323 of 7nbfAAA
- active site: K53 (= K32), S81 (= S56), E207 (≠ Q188), A211 (≠ C192), D213 (≠ A197), G236 (= G218)
- binding calcium ion: E207 (≠ Q188), A211 (≠ C192), D213 (≠ A197)
- binding magnesium ion: N244 (≠ R226)
- binding pyridoxal-5'-phosphate: F52 (= F31), K53 (= K32), N83 (= N58), G182 (= G157), G183 (≠ A158), G184 (= G159), G185 (≠ S160), M186 (≠ S161), G236 (= G218), V237 (≠ T219), T282 (= T266)
- binding 2-[(methylsulfonyl)methyl]-1H-benzimidazole: F46 (= F25)
Sites not aligning to the query:
7nbdAAA structure of human serine racemase in complex with DSiP fragment Z235449082, XChem fragment screen (see paper)
29% identity, 83% coverage: 19:274/309 of query aligns to 40:290/323 of 7nbdAAA
- active site: K53 (= K32), S81 (= S56), E207 (≠ Q188), A211 (≠ C192), D213 (≠ A197), G236 (= G218)
- binding calcium ion: E207 (≠ Q188), A211 (≠ C192), D213 (≠ A197)
- binding [4-(1H-benzimidazol-1-yl)phenyl]methanol: W272 (vs. gap), L278 (≠ F262)
- binding magnesium ion: N244 (≠ R226)
- binding pyridoxal-5'-phosphate: F52 (= F31), K53 (= K32), N83 (= N58), G182 (= G157), G183 (≠ A158), G184 (= G159), G185 (≠ S160), M186 (≠ S161), G236 (= G218), V237 (≠ T219), E280 (= E264), T282 (= T266)
Sites not aligning to the query:
7nbcCCC structure of human serine racemase in complex with DSiP fragment Z2856434779, XChem fragment screen (see paper)
29% identity, 83% coverage: 19:274/309 of query aligns to 40:290/323 of 7nbcCCC
- active site: K53 (= K32), S81 (= S56), E207 (≠ Q188), A211 (≠ C192), D213 (≠ A197), G236 (= G218)
- binding biphenyl-4-ylacetic acid: T78 (≠ E53), H79 (≠ D54), H84 (≠ G59), V148 (≠ A121), H149 (≠ S122), P150 (≠ H123)
- binding calcium ion: E207 (≠ Q188), A211 (≠ C192), D213 (≠ A197)
- binding pyridoxal-5'-phosphate: F52 (= F31), K53 (= K32), N83 (= N58), G182 (= G157), G183 (≠ A158), G184 (= G159), G185 (≠ S160), M186 (≠ S161), G236 (= G218), V237 (≠ T219), T282 (= T266)
Sites not aligning to the query:
7nbcAAA structure of human serine racemase in complex with DSiP fragment Z2856434779, XChem fragment screen (see paper)
29% identity, 83% coverage: 19:274/309 of query aligns to 40:290/323 of 7nbcAAA
- active site: K53 (= K32), S81 (= S56), E207 (≠ Q188), A211 (≠ C192), D213 (≠ A197), G236 (= G218)
- binding calcium ion: E207 (≠ Q188), A211 (≠ C192), D213 (≠ A197)
- binding magnesium ion: N244 (≠ R226)
- binding pyridoxal-5'-phosphate: F52 (= F31), K53 (= K32), N83 (= N58), G182 (= G157), G183 (≠ A158), G184 (= G159), G185 (≠ S160), M186 (≠ S161), G236 (= G218), V237 (≠ T219), T282 (= T266)
Sites not aligning to the query:
Query Sequence
>WP_085984982.1 NCBI__GCF_000022085.1:WP_085984982.1
MGEGCTPLVQRPWGDLRPFFKLEWFNPTGSFKDRGSSVMLSFLRQIGVDAVLEDSSGNGG
SSMAGFGAAGGVRVKILAPAYTSPAKIAQVRAYGAEVQLVEGPREESEAEAIRQSGQTFY
ASHNWQPFFLEGTKSLAYELWEDFGFKVPDNIIIPVGAGSSLLGCAFGFRELMKAGQITK
LPRLFVAQPLNCSPIDASFQAGVDTPLTREVHKTIAEGTAIKHPLRLREIIAALRESGGG
TIALTEEEIIAALRRLARQGLFAEPTCASAAAALDTLSSAGSIKAGESTVVIVTGTGLKA
ASTVADVVQ
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory