Comparing WP_086508092.1 NCBI__GCF_002151265.1:WP_086508092.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
37% identity, 88% coverage: 1:244/277 of query aligns to 1:231/343 of P30750
Sites not aligning to the query:
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
37% identity, 88% coverage: 1:244/277 of query aligns to 2:232/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
37% identity, 88% coverage: 1:244/277 of query aligns to 2:232/344 of 3tuiC
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
37% identity, 88% coverage: 1:244/277 of query aligns to 2:232/344 of 6cvlD
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
38% identity, 79% coverage: 16:233/277 of query aligns to 16:223/241 of 4u00A
Sites not aligning to the query:
3c4jA Abc protein artp in complex with atp-gamma-s
33% identity, 84% coverage: 1:233/277 of query aligns to 3:225/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
33% identity, 84% coverage: 1:233/277 of query aligns to 3:225/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
33% identity, 84% coverage: 1:233/277 of query aligns to 3:225/242 of 2olkA
2oljA Abc protein artp in complex with adp/mg2+
33% identity, 84% coverage: 1:233/277 of query aligns to 3:225/242 of 2oljA
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
32% identity, 84% coverage: 1:233/277 of query aligns to 1:223/240 of 4ymuJ
1f3oA Crystal structure of mj0796 atp-binding cassette (see paper)
34% identity, 81% coverage: 1:224/277 of query aligns to 1:223/232 of 1f3oA
1l2tA Dimeric structure of mj0796, a bacterial abc transporter cassette (see paper)
34% identity, 81% coverage: 1:224/277 of query aligns to 1:223/230 of 1l2tA
8iddA Cryo-em structure of mycobacterium tuberculosis atp bound ftsex/ripc complex in peptidisc (see paper)
37% identity, 83% coverage: 1:231/277 of query aligns to 2:224/225 of 8iddA
8igqA Cryo-em structure of mycobacterium tuberculosis adp bound ftsex/ripc complex in peptidisc (see paper)
37% identity, 83% coverage: 1:231/277 of query aligns to 2:224/227 of 8igqA
A5U7B7 Cell division ATP-binding protein FtsE from Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) (see 2 papers)
37% identity, 83% coverage: 1:231/277 of query aligns to 1:223/229 of A5U7B7
6z4wA Ftse structure from streptococcus pneumoniae in complex with adp (space group p 1) (see paper)
32% identity, 85% coverage: 1:236/277 of query aligns to 3:229/230 of 6z4wA
A0A0H2ZM82 Cell division ATP-binding protein FtsE from Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) (see paper)
32% identity, 85% coverage: 1:236/277 of query aligns to 3:229/230 of A0A0H2ZM82
6z67B Ftse structure of streptococcus pneumoniae in complex with amppnp at 2.4 a resolution (see paper)
32% identity, 85% coverage: 1:236/277 of query aligns to 3:229/229 of 6z67B
5xu1B Structure of a non-canonical abc transporter from streptococcus pneumoniae r6 (see paper)
36% identity, 82% coverage: 1:227/277 of query aligns to 3:223/226 of 5xu1B
P9WQK5 Uncharacterized ABC transporter ATP-binding protein Rv0073 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
36% identity, 82% coverage: 2:227/277 of query aligns to 4:239/330 of P9WQK5
>WP_086508092.1 NCBI__GCF_002151265.1:WP_086508092.1
MLTLSQVTKRYPTGDRALTDIDLNLPRGQVMALIGPSGAGKSTLIRCVNRLVEPTSGSIR
LEDTELTRLSGAALRRARRSMAMIFQEYALVDRLTVMENVLSGRLGYVGFWRSFTRRYPQ
EDIAEAFRLLDRVGLTHAMDKRADALSGGQRQRVGIARALIQSPRLLLVDEPTASLDPKT
SRQIMRLIRELCAERELAAIINIHDVALAQQFADRIVGLRAGQIVFDGKPGELDADTLTT
IYGEEEWDTRVQDDIGESTPPREVPASRLMLASGGAS
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory