SitesBLAST
Comparing WP_086508101.1 NCBI__GCF_002151265.1:WP_086508101.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3dtgA Structural analysis of mycobacterial branched chain aminotransferase- implications for inhibitor design
58% identity, 99% coverage: 4:357/358 of query aligns to 8:362/363 of 3dtgA
- active site: K199 (= K198)
- binding O-benzylhydroxylamine: F72 (= F68), Y171 (= Y170), Y204 (= Y203)
- binding pyridoxal-5'-phosphate: R96 (= R92), R189 (= R188), K199 (= K198), Y204 (= Y203), E235 (= E234), G238 (= G237), L263 (= L259), I266 (≠ V262), T267 (= T263), T309 (= T305)
3dtfA Structural analysis of mycobacterial branched chain aminotransferase- implications for inhibitor design (see paper)
58% identity, 99% coverage: 4:357/358 of query aligns to 8:362/363 of 3dtfA
A0R066 Branched-chain-amino-acid aminotransferase; BCAT; EC 2.6.1.42 from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see 2 papers)
58% identity, 99% coverage: 4:357/358 of query aligns to 13:367/368 of A0R066
- R101 (= R92) binding
- Y209 (= Y203) binding
- K299 (≠ D290) modified: Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-Cter in protein Pup)
- T314 (= T305) binding
3ht5A Crystal structure of ilve a branched chain amino acid transaminase from mycobacterium tuberculosis (see paper)
57% identity, 93% coverage: 25:357/358 of query aligns to 1:334/335 of 3ht5A
- active site: K171 (= K198)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: R68 (= R92), K171 (= K198), Y176 (= Y203), E207 (= E234), G210 (= G237), M211 (= M238), N212 (= N239), L235 (= L259), G237 (= G261), I238 (≠ V262), T239 (= T263), T281 (= T305)
5u3fA Structure of mycobacterium tuberculosis ilve, a branched-chain amino acid transaminase, in complex with d-cycloserine derivative (see paper)
55% identity, 92% coverage: 27:357/358 of query aligns to 2:325/326 of 5u3fA
- active site: K162 (= K198)
- binding (5-hydroxy-6-methyl-4-{[(3-oxo-2,3-dihydro-1,2-oxazol-4-yl)amino]methyl}pyridin-3-yl)methyl dihydrogen phosphate: G45 (= G70), R67 (= R92), Y110 (= Y138), K162 (= K198), Y167 (= Y203), E198 (= E234), G201 (= G237), M202 (= M238), N203 (= N239), L226 (= L259), G228 (= G261), I229 (≠ V262), T230 (= T263), T272 (= T305)
7nyaA Crystal structure of human cytosolic branched-chain aminotransferase (bcat1) in complex with plp and small molecule inhibitor bay-069 (compound 36) (see paper)
41% identity, 92% coverage: 19:348/358 of query aligns to 24:356/364 of 7nyaA
- binding pyridoxal-5'-phosphate: R97 (= R92), R190 (= R188), K200 (= K198), Y205 (= Y203), E235 (= E234), T238 (≠ G237), M239 (= M238), L264 (= L259), G266 (= G261), V267 (= V262), T268 (= T263), G310 (= G304), T311 (= T305)
- binding 3-[4-chloranyl-3-(2-methylphenoxy)naphthalen-1-yl]-6-(trifluoromethyl)-5~{H}-pyrimidine-2,4-dione: F27 (= F22), Y68 (= Y63), F73 (= F68), Y139 (= Y138), G152 (= G151), V153 (= V152), Y171 (= Y170), Q212 (= Q210), Q222 (= Q220), T238 (≠ G237), A312 (= A306)
7ny9A Crystal structure of human cytosolic branched-chain aminotransferase (bcat1) in complex with plp and small molecule inhibitor compound 38 (see paper)
41% identity, 92% coverage: 19:348/358 of query aligns to 24:356/364 of 7ny9A
- binding pyridoxal-5'-phosphate: R97 (= R92), R190 (= R188), K200 (= K198), Y205 (= Y203), E235 (= E234), T238 (≠ G237), M239 (= M238), N240 (= N239), L264 (= L259), G266 (= G261), V267 (= V262), T268 (= T263), T311 (= T305)
- binding 3-[2,6-bis(oxidanylidene)-4-(trifluoromethyl)-5~{H}-pyrimidin-1-yl]-~{N}-methyl-2-pyridin-2-yl-imidazo[1,2-a]pyridine-7-carboxamide: F27 (= F22), Y139 (= Y138), G152 (= G151), V153 (= V152), Y171 (= Y170), Q212 (= Q210), Q221 (≠ S219), Q222 (= Q220), V223 (= V221), T238 (≠ G237)
7ny2A Crystal structure of human cytosolic branched-chain aminotransferase (bcat1) in complex with plp and small molecule inhibitor compound 35 (see paper)
41% identity, 92% coverage: 19:348/358 of query aligns to 24:356/364 of 7ny2A
- binding pyridoxal-5'-phosphate: R97 (= R92), K200 (= K198), Y205 (= Y203), E235 (= E234), T238 (≠ G237), M239 (= M238), L264 (= L259), G266 (= G261), V267 (= V262), T268 (= T263), T311 (= T305)
- binding 4-[2,4-bis(oxidanylidene)-6-(trifluoromethyl)-1H-pyrimidin-3-yl]-2-(2-methylphenoxy)naphthalene-1-carbonitrile: F27 (= F22), Y139 (= Y138), G152 (= G151), V153 (= V152), Y171 (= Y170), Q212 (= Q210), Q222 (= Q220), A312 (= A306)
7nwmA Crystal structure of human cytosolic branched-chain aminotransferase (bcat1) in complex with plp and inhibitor compound 12 (see paper)
41% identity, 92% coverage: 19:348/358 of query aligns to 25:357/365 of 7nwmA
- binding pyridoxal-5'-phosphate: R98 (= R92), R191 (= R188), K201 (= K198), Y206 (= Y203), E236 (= E234), T239 (≠ G237), M240 (= M238), L265 (= L259), G267 (= G261), V268 (= V262), T269 (= T263), G311 (= G304), T312 (= T305)
- binding 4-[2,4-bis(oxidanylidene)-6-(trifluoromethyl)-1H-pyrimidin-3-yl]-5-methoxy-2-(2-methylphenoxy)benzenecarbonitrile: F28 (= F22), Y69 (= Y63), F74 (= F68), Y140 (= Y138), G153 (= G151), V154 (= V152), Y172 (= Y170), Q213 (= Q210), Q223 (= Q220), T239 (≠ G237), A313 (= A306)
7nweA Crystal structure of human cytosolic branched-chain aminotransferase (bcat1) in complex with plp and inhibitor compound 10 (see paper)
41% identity, 92% coverage: 19:348/358 of query aligns to 25:357/365 of 7nweA
- binding pyridoxal-5'-phosphate: R98 (= R92), K201 (= K198), Y206 (= Y203), E236 (= E234), T239 (≠ G237), M240 (= M238), L265 (= L259), G267 (= G261), V268 (= V262), T269 (= T263), G311 (= G304), T312 (= T305)
- binding 4-[2,4-bis(oxidanylidene)-6-(trifluoromethyl)-1H-pyrimidin-3-yl]-5-methyl-2-(2-methylphenoxy)benzenecarbonitrile: F28 (= F22), Y69 (= Y63), F74 (= F68), Y140 (= Y138), G153 (= G151), V154 (= V152), Y172 (= Y170), Q213 (= Q210), Q223 (= Q220), T239 (≠ G237), A313 (= A306)
7nwcA Crystal structure of human cytosolic branched-chain aminotransferase (bcat1) in complex with plp and inhibitor compound 2 (see paper)
41% identity, 92% coverage: 19:348/358 of query aligns to 25:357/365 of 7nwcA
- binding pyridoxal-5'-phosphate: R98 (= R92), R191 (= R188), K201 (= K198), Y206 (= Y203), E236 (= E234), T239 (≠ G237), M240 (= M238), N241 (= N239), L265 (= L259), G267 (= G261), V268 (= V262), T269 (= T263), G311 (= G304), T312 (= T305)
- binding 3-(5-chloranyl-2,4-dimethoxy-phenyl)-6-(trifluoromethyl)-1H-pyrimidine-2,4-dione: F28 (= F22), Y172 (= Y170), Q223 (= Q220), T239 (≠ G237), A313 (= A306)
7nwbA Crystal structure of human cytosolic branched-chain aminotransferase (bcat1) in complex with plp and inhibitor compound 1 (see paper)
41% identity, 92% coverage: 19:348/358 of query aligns to 25:357/365 of 7nwbA
- binding pyridoxal-5'-phosphate: R98 (= R92), R191 (= R188), K201 (= K198), Y206 (= Y203), E236 (= E234), T239 (≠ G237), M240 (= M238), L265 (= L259), G267 (= G261), V268 (= V262), T269 (= T263), G311 (= G304), T312 (= T305)
- binding 4-[2,4-bis(oxidanylidene)-6-(trifluoromethyl)-1H-pyrimidin-3-yl]-5-fluoranyl-2-(2-methylphenoxy)benzenecarbonitrile: F28 (= F22), Y69 (= Y63), F74 (= F68), Y140 (= Y138), G153 (= G151), V154 (= V152), Y172 (= Y170), Q213 (= Q210), Q223 (= Q220), A313 (= A306)
7nwaA Crystal structure of human cytosolic branched-chain aminotransferase (bcat1) in complex with plp and compound a (see paper)
41% identity, 92% coverage: 19:348/358 of query aligns to 25:357/365 of 7nwaA
- binding pyridoxal-5'-phosphate: R98 (= R92), K201 (= K198), Y206 (= Y203), E236 (= E234), T239 (≠ G237), N241 (= N239), L265 (= L259), G267 (= G261), V268 (= V262), T269 (= T263), T312 (= T305)
- binding 2-[[4-chloranyl-2,6-bis(fluoranyl)phenyl]methylamino]-7-oxidanylidene-5-propyl-4H-pyrazolo[1,5-a]pyrimidine-3-carbonitrile: R142 (= R140), G153 (= G151), V154 (= V152), Y172 (= Y170), F173 (= F171), V181 (= V178), Q223 (= Q220), V237 (≠ L235), T239 (≠ G237), M240 (= M238), G311 (= G304), A313 (= A306), C317 (≠ T310)
7nxoA Crystal structure of human cytosolic branched-chain aminotransferase (bcat1) in complex with plp and small molecule inhibitor compound 24(5-f) (see paper)
41% identity, 92% coverage: 19:348/358 of query aligns to 24:353/361 of 7nxoA
- binding pyridoxal-5'-phosphate: R97 (= R92), K197 (= K198), Y202 (= Y203), E232 (= E234), T235 (≠ G237), M236 (= M238), N237 (= N239), L261 (= L259), G263 (= G261), V264 (= V262), T265 (= T263), T308 (= T305)
- binding 4-[2,4-bis(oxidanylidene)-6-(phenylsulfonyl)-1H-pyrimidin-3-yl]-5-fluoranyl-2-(2-methylphenoxy)benzenecarbonitrile: F27 (= F22), Y68 (= Y63), F73 (= F68), G152 (= G151), V153 (= V152), Y171 (= Y170), F172 (= F171), Q209 (= Q210), Q218 (≠ S219), Q219 (= Q220), T235 (≠ G237)
7nxnA Crystal structure of human cytosolic branched-chain aminotransferase (bcat1) in complex with plp and small molecule inhibitor compound 21(5-f) (see paper)
41% identity, 92% coverage: 19:348/358 of query aligns to 25:354/362 of 7nxnA
- binding pyridoxal-5'-phosphate: R98 (= R92), R188 (= R188), K198 (= K198), Y203 (= Y203), E233 (= E234), T236 (≠ G237), M237 (= M238), N238 (= N239), L262 (= L259), G264 (= G261), V265 (= V262), T266 (= T263), T309 (= T305)
- binding 4-[6-[bis(fluoranyl)-phenyl-methyl]-2,4-bis(oxidanylidene)-1~{H}-pyrimidin-3-yl]-5-fluoranyl-2-(2-methylphenoxy)benzenecarbonitrile: F28 (= F22), Y69 (= Y63), F74 (= F68), G153 (= G151), V154 (= V152), Y172 (= Y170), Q210 (= Q210), Q219 (≠ S219), Q220 (= Q220), T236 (≠ G237)
7ntrA Crystal structure of human cytosolic branched-chain aminotransferase (bcat1) in complex with plp and substrate mimic 3-phenylpropionate (see paper)
41% identity, 92% coverage: 19:348/358 of query aligns to 25:354/362 of 7ntrA
- binding hydrocinnamic acid: F28 (= F22), Y69 (= Y63), V154 (= V152), T236 (≠ G237), G308 (= G304), T309 (= T305), A310 (= A306)
- binding pyridoxal-5'-phosphate: R98 (= R92), R188 (= R188), K198 (= K198), Y203 (= Y203), E233 (= E234), T236 (≠ G237), M237 (= M238), L262 (= L259), G264 (= G261), V265 (= V262), T266 (= T263), G308 (= G304), T309 (= T305)
2abjA Crystal structure of human branched chain amino acid transaminase in a complex with an inhibitor, c16h10n2o4f3scl, and pyridoxal 5' phosphate. (see paper)
41% identity, 92% coverage: 19:348/358 of query aligns to 26:358/366 of 2abjA
- active site: K202 (= K198)
- binding n'-(5-chlorobenzofuran-2-carbonyl)-2-(trifluoromethyl)benzenesulfonohydrazide: F29 (= F22), F75 (= F68), Y141 (= Y138), Y173 (= Y170), K202 (= K198), Q224 (= Q220), T240 (≠ G237), M241 (= M238), G312 (= G304), A314 (= A306), C315 (≠ A307)
- binding pyridoxal-5'-phosphate: R99 (= R92), R192 (= R188), K202 (= K198), Y207 (= Y203), E237 (= E234), T240 (≠ G237), M241 (= M238), N242 (= N239), L266 (= L259), G268 (= G261), V269 (= V262), T270 (= T263), T313 (= T305)
2coiA Crystal structure of oxidized human cytosolic branched-chain aminotransferase complexed with gabapentin (see paper)
41% identity, 92% coverage: 19:348/358 of query aligns to 24:351/358 of 2coiA
- active site: K195 (= K198)
- binding [1-(aminomethyl)cyclohexyl]acetic acid: Y68 (= Y63), R141 (= R140), V153 (= V152), T233 (≠ G237), G305 (= G304), T306 (= T305), A307 (= A306)
- binding pyridoxal-5'-phosphate: R97 (= R92), R185 (= R188), K195 (= K198), Y200 (= Y203), E230 (= E234), T233 (≠ G237), L259 (= L259), G261 (= G261), V262 (= V262), T263 (= T263), T306 (= T305)
2cogA Crystal structure of oxidized human cytosolic branched-chain aminotransferase complexed with 4-methylvalerate (see paper)
41% identity, 92% coverage: 19:348/358 of query aligns to 24:351/358 of 2cogA
- active site: K195 (= K198)
- binding 4-methyl valeric acid: Y171 (= Y170), T233 (≠ G237), T306 (= T305), A307 (= A306)
- binding pyridoxal-5'-phosphate: R97 (= R92), K195 (= K198), Y200 (= Y203), E230 (= E234), T233 (≠ G237), L259 (= L259), G261 (= G261), V262 (= V262), T263 (= T263), T306 (= T305)
2hdkB Crystal structure of cys315ala-cys318ala mutant of human mitochondrial branched chain aminotransferase (see paper)
40% identity, 93% coverage: 22:354/358 of query aligns to 28:360/363 of 2hdkB
- active site: K200 (= K198)
- binding 2-oxo-4-methylpentanoic acid: G310 (= G304), T311 (= T305), A312 (= A306)
- binding pyridoxal-5'-phosphate: R97 (= R92), K200 (= K198), Y205 (= Y203), E235 (= E234), T238 (≠ G237), L264 (= L259), G266 (= G261), V267 (= V262), V268 (≠ T263), G310 (= G304), T311 (= T305)
Query Sequence
>WP_086508101.1 NCBI__GCF_002151265.1:WP_086508101.1
MLPTATPTAANIRADILANPGFGLHFTDHMAHVRWTADAGWHGHEVRPYGPLTLDPAAAV
LHYGQEIFEGIKAYRHADGSVWSFRPEKNAERFRRSARRLALPELDDETFVESLRALMQL
DQGWVPTPKNAGDESSLYLRPFMIASEKFLGVRPAKEVDYYVIASPAGAYFKGGIAPVSI
WLSSHYKRAAPGGTGFAKCGGNYAASLAAQKEAEKHGCSQVAFLDAAENKWIEELGGMNL
FFVYKDGRLVTPRLTDTILEGVTRDSVLTLGRDEGLTPEERAISIDEWRDGVASGDIAEV
FACGTAAVITPVGQLVTEEGTVQMPDAGNEIAKRLRGKLLDLQYGRAEDKHGWLTKLI
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory