Comparing WP_086508118.1 NCBI__GCF_002151265.1:WP_086508118.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
8j5qD Cryo-em structure of mycobacterium tuberculosis oppabcd in the pre- translocation state (see paper)
42% identity, 81% coverage: 6:629/766 of query aligns to 3:608/611 of 8j5qD
8j5tD Cryo-em structure of mycobacterium tuberculosis oppabcd in the catalytic intermediate state (see paper)
42% identity, 81% coverage: 6:629/766 of query aligns to 3:608/608 of 8j5tD
8j5sD Cryo-em structure of mycobacterium tuberculosis oppabcd in the pre- catalytic intermediate state (see paper)
42% identity, 81% coverage: 6:629/766 of query aligns to 3:608/608 of 8j5sD
Q8RDH4 Dipeptide transport ATP-binding protein DppD; EC 7.4.2.9 from Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) (Thermoanaerobacter tengcongensis) (see paper)
42% identity, 42% coverage: 6:326/766 of query aligns to 4:326/326 of Q8RDH4
4fwiB Crystal structure of the nucleotide-binding domain of a dipeptide abc transporter (see paper)
43% identity, 41% coverage: 6:317/766 of query aligns to 3:306/310 of 4fwiB
P0AAH4 Putrescine export system ATP-binding protein SapD from Escherichia coli (strain K12) (see paper)
36% identity, 42% coverage: 6:323/766 of query aligns to 3:328/330 of P0AAH4
7z15I E. Coli c-p lyase bound to a phnk/phnl dual abc dimer and adp + pi (see paper)
36% identity, 33% coverage: 4:257/766 of query aligns to 1:246/253 of 7z15I
7z18I E. Coli c-p lyase bound to a phnk abc dimer and atp (see paper)
36% identity, 33% coverage: 4:257/766 of query aligns to 1:246/250 of 7z18I
7z16I E. Coli c-p lyase bound to phnk/phnl dual abc dimer with amppnp and phnk e171q mutation (see paper)
36% identity, 33% coverage: 4:257/766 of query aligns to 1:246/250 of 7z16I
P0A9R7 Cell division ATP-binding protein FtsE from Escherichia coli (strain K12) (see paper)
39% identity, 25% coverage: 393:583/766 of query aligns to 17:200/222 of P0A9R7
8w6iD Cryo-em structure of escherichia coli str k12 ftsex complex with atp- gamma-s in peptidisc
39% identity, 25% coverage: 393:583/766 of query aligns to 17:200/219 of 8w6iD
Sites not aligning to the query:
8hd0A Cell divisome spg hydrolysis machinery ftsex-envc
39% identity, 25% coverage: 393:583/766 of query aligns to 17:200/218 of 8hd0A
Sites not aligning to the query:
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
31% identity, 31% coverage: 389:627/766 of query aligns to 16:248/343 of P30750
Sites not aligning to the query:
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
30% identity, 31% coverage: 389:627/766 of query aligns to 17:249/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
30% identity, 31% coverage: 389:627/766 of query aligns to 17:249/344 of 3tuiC
Sites not aligning to the query:
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
30% identity, 31% coverage: 389:627/766 of query aligns to 17:249/344 of 6cvlD
Sites not aligning to the query:
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
36% identity, 30% coverage: 391:621/766 of query aligns to 15:237/241 of 4u00A
Sites not aligning to the query:
2d62A Crystal structure of multiple sugar binding transport atp- binding protein
36% identity, 28% coverage: 391:607/766 of query aligns to 19:230/375 of 2d62A
3c4jA Abc protein artp in complex with atp-gamma-s
35% identity, 34% coverage: 362:620/766 of query aligns to 3:238/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
35% identity, 34% coverage: 362:620/766 of query aligns to 3:238/242 of 3c41J
>WP_086508118.1 NCBI__GCF_002151265.1:WP_086508118.1
MTDQRLLKVEDLAIHYRTGAGPVQAVDGIHFDLRPGEALGLVGESGCGKTTAAKAMLRLL
PPNGEVPRGRIDFDGRDLVALDEESMRKVRWKEIAWISQAAMNALDPVYTVGDQILEAMN
AHIKIDRKTAWAHAEELFRAVGIDPGRLSAYPHEMSGGMKQRAVIAMALALDPKLIIADE
PTTALDVVTQAQILARLSKLRRERGMGLLFITHDISVVVQTCDRVAVMYGGHIMETGPVR
EVFGTPFHPYTMGLTNAFPTLEGAQRELISIPGSPPDLLNPPSGCRFAERCPFATERCVR
ETPPLHPVGEERQAACHYPDQAEAFRVKAALNETWAVVGERLNEPVQGAGSIEHLETEAP
LLLEVEELKKHFPVEQGFLDGLRGRNKDRKVHAVDGISFDLREGEILGLAGESGSGKTTT
GEMLVRLLDVTEGEIRFEGADIAQLTGRELKTFRRRAQMIFQDPYQTLNPRFTIFDIVAE
PLIIHRLAEGEALRQKVVVALERAGLKPAEVYAERFPHELSGGQRQRVAIARAIVLEPRF
IVADEPVSMLDVSIRAGVLNLMHRFRNELGISFVYVSHDLPTIRYVADRTAIMYLGEIVE
VGPTEQVVRERKHPYTQLLLEASPEPDPAVVKPPLESAGEIPSAVEPPNGCHFHTRCPRA
MAHCGWEGRDVITALSEWRIAGREIEHLGSAEVAGLDVHLQVRGGDIGAAERELVEVMRA
KHPALAEAGRIEQGAEGALSVRFQAQVSPQRRQVADQHSVACYLYE
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory