Comparing WP_086508134.1 NCBI__GCF_002151265.1:WP_086508134.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4hzdA Crystal structure of serine acetyltransferase in complex with coenzyme a from brucella abortus strain s19 (see paper)
47% identity, 57% coverage: 5:168/288 of query aligns to 81:244/250 of 4hzdA
4h7oA Crystal structure of serine acetyltransferase from vibrio cholerae o1 biovar el tor n16961
48% identity, 58% coverage: 8:174/288 of query aligns to 80:246/258 of 4h7oA
Sites not aligning to the query:
1t3dA Crystal structure of serine acetyltransferase from e.Coli at 2.2a (see paper)
46% identity, 58% coverage: 8:174/288 of query aligns to 84:250/262 of 1t3dA
8i04A Crystal structure of serine acetyltransferase from salmonella typhimurium complexed with serine (see paper)
45% identity, 60% coverage: 1:174/288 of query aligns to 73:246/258 of 8i04A
3gvdI Crystal structure of serine acetyltransferase cyse from yersinia pestis
46% identity, 60% coverage: 1:174/288 of query aligns to 80:253/272 of 3gvdI
8i09A Crystal structure of serine acetyltransferase from salmonella typhimurium complexed with butyl gallate (see paper)
46% identity, 59% coverage: 1:170/288 of query aligns to 76:245/246 of 8i09A
8i06A Crystal structure of serine acetyltransferase from salmonella typhimurium complexed with coa (see paper)
46% identity, 58% coverage: 1:168/288 of query aligns to 77:244/244 of 8i06A
7bw9A Crystal structure of serine acetyltransferase isoform 3 in complex with cysteine from entamoeba histolytica
45% identity, 52% coverage: 5:154/288 of query aligns to 103:252/280 of 7bw9A
1ssqD Serine acetyltransferase- complex with cysteine (see paper)
45% identity, 57% coverage: 8:170/288 of query aligns to 80:242/257 of 1ssqD
6wyeA Crystal structure of neisseria gonorrhoeae serine acetyltransferase (cyse) (see paper)
41% identity, 58% coverage: 5:171/288 of query aligns to 82:248/261 of 6wyeA
4n69A Soybean serine acetyltransferase complexed with serine (see paper)
43% identity, 56% coverage: 8:168/288 of query aligns to 83:243/243 of 4n69A
7ra4A Crystal structure of neisseria gonorrhoeae serine acetyltransferase (cyse) in complex with serine (see paper)
41% identity, 57% coverage: 5:168/288 of query aligns to 80:243/243 of 7ra4A
1sstA Serine acetyltransferase- complex with coa (see paper)
45% identity, 56% coverage: 8:168/288 of query aligns to 80:233/233 of 1sstA
3p47A Crystal structure of entamoeba histolytica serine acetyltransferase 1 in complex with l-cysteine (see paper)
40% identity, 54% coverage: 5:160/288 of query aligns to 105:268/270 of 3p47A
3q1xA Crystal structure of entamoeba histolytica serine acetyltransferase 1 in complex with l-serine (see paper)
40% identity, 54% coverage: 5:160/288 of query aligns to 103:266/267 of 3q1xA
4n6bA Soybean serine acetyltransferase complexed with coa (see paper)
42% identity, 56% coverage: 8:168/288 of query aligns to 79:233/233 of 4n6bA
4mzuF Crystal structure of fdtd, a bifunctional ketoisomerase/n- acetyltransferase from shewanella denitrificans (see paper)
35% identity, 29% coverage: 85:167/288 of query aligns to 58:140/294 of 4mzuF
Sites not aligning to the query:
A1ADJ6 Polysialic acid O-acetyltransferase; Capsule O-acetyl transferase; EC 2.3.1.136 from Escherichia coli O1:K1 / APEC (see paper)
30% identity, 43% coverage: 61:183/288 of query aligns to 136:296/307 of A1ADJ6
G3XD01 UDP-2-acetamido-3-amino-2,3-dideoxy-D-glucuronate N-acetyltransferase; UDP-D-GlcNAc3NA N-acetyltransferase; UDP-2-acetamido-3-amino-2,3-dideoxy-alpha-D-glucuronic acid 3-N-acetyltransferase; EC 2.3.1.201 from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see paper)
28% identity, 38% coverage: 59:166/288 of query aligns to 26:150/191 of G3XD01
P07464 Galactoside O-acetyltransferase; GAT; Acetyl-CoA:galactoside 6-O-acetyltransferase; Thiogalactoside acetyltransferase; Thiogalactoside transacetylase; EC 2.3.1.18 from Escherichia coli (strain K12) (see 3 papers)
26% identity, 34% coverage: 74:172/288 of query aligns to 78:186/203 of P07464
Sites not aligning to the query:
>WP_086508134.1 NCBI__GCF_002151265.1:WP_086508134.1
MFQRLREDINSVFDRDPAARNFLEVLTNYPGLHALLLHRLAHWLWHKRLKWLARTLSTFS
RWLTGIEIHPGAKIGRRFFIDHGMGVVIGETAEVGDDVTLYQGVTLGGTSWNKGKRHPTL
EDGVIVGAGAKILGPFTVGTGAKIGSNAVVTKEVPAGATVVGIPGKIVKRADPDAAEVLE
VDPERREAMRRKFGFDAYGVSEDMPDPVARSIQAMLDHMHAVDERIERMCSTLRKLDASY
REGKLPELRDEDFADILSDVDACCGPTAGSRTEHDGDQGNGEPPRGNG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory