Comparing WP_086508157.1 NCBI__GCF_002151265.1:WP_086508157.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5az7A Crystal structure of mbp-tom20 fusion protein with a 4-residue spacer in the connector helix (see paper)
50% identity, 92% coverage: 31:395/395 of query aligns to 6:370/434 of 5az7A
3csbA Crystal structure of monobody ysx1/maltose binding protein fusion complex (see paper)
50% identity, 92% coverage: 31:395/395 of query aligns to 3:367/464 of 3csbA
1llsA Crystal structure of unliganded maltose binding protein with xenon (see paper)
50% identity, 92% coverage: 31:395/395 of query aligns to 6:370/370 of 1llsA
1ez9B Structure of maltotetraitol bound to open-form maltodextrin binding protein in p1 crystal form (see paper)
50% identity, 92% coverage: 31:395/395 of query aligns to 6:370/370 of 1ez9B
6k7fA Crystal structure of mbpholo-tim21 fusion protein with a 17-residue helical linker (see paper)
50% identity, 92% coverage: 31:393/395 of query aligns to 7:369/499 of 6k7fA
3woaA Crystal structure of lambda repressor (1-45) fused with maltose- binding protein (see paper)
49% identity, 95% coverage: 16:389/395 of query aligns to 38:411/413 of 3woaA
6m4wA Crystal structure of mbp fused split fkbp-frb t2098l mutant in complex with rapamycin (see paper)
50% identity, 91% coverage: 31:389/395 of query aligns to 7:365/403 of 6m4wA
5y2gA Structure of mbp tagged gbs camp (see paper)
50% identity, 89% coverage: 31:381/395 of query aligns to 4:354/581 of 5y2gA
7wr3A Crystal structure of mbp-fused ospc3 in complex with calmodulin (see paper)
50% identity, 89% coverage: 31:381/395 of query aligns to 6:356/794 of 7wr3A
Sites not aligning to the query:
5h7qA Crystal structure of human mnda pyd domain with mbp tag (see paper)
50% identity, 89% coverage: 31:381/395 of query aligns to 6:356/469 of 5h7qA
7cy5A Crystal structure of cmd1 in complex with vitamin c (see paper)
50% identity, 89% coverage: 31:381/395 of query aligns to 3:353/862 of 7cy5A
Sites not aligning to the query:
7cy6A Crystal structure of cmd1 in complex with 5mc-DNA (see paper)
50% identity, 89% coverage: 31:381/395 of query aligns to 5:355/872 of 7cy6A
Sites not aligning to the query:
5tj2D Gasdermin-b c-terminal domain containing the polymorphism residues gly299:ser306 fused to maltose binding protein
50% identity, 89% coverage: 31:381/395 of query aligns to 6:356/528 of 5tj2D
5hz7A High-resolution crystal structure of the minor DNA-binding pilin comp from neisseria meningitidis in fusion with mbp (see paper)
50% identity, 89% coverage: 31:381/395 of query aligns to 7:357/490 of 5hz7A
5tj4E Gasdermin-b c-terminal domain containing the polymorphism residues gly299:pro306 fused to maltose binding protein (see paper)
50% identity, 89% coverage: 31:381/395 of query aligns to 6:356/556 of 5tj4E
6sjvA Structure of hpv18 e6 oncoprotein in complex with mutant e6ap lxxll motif
50% identity, 89% coverage: 31:381/395 of query aligns to 6:356/529 of 6sjvA
Sites not aligning to the query:
6d67A Crystal structure of the human dual specificity phosphatase 1 catalytic domain (c258s) as a maltose binding protein fusion (maltose bound form) in complex with the designed ar protein mbp3_16 (see paper)
50% identity, 89% coverage: 31:381/395 of query aligns to 6:356/514 of 6d67A
1hsjA Sarr mbp fusion structure (see paper)
50% identity, 90% coverage: 31:384/395 of query aligns to 6:359/487 of 1hsjA
8c5lB Nr2f6 ligand binding domain in complex with nsd1 peptide
50% identity, 89% coverage: 31:381/395 of query aligns to 7:357/557 of 8c5lB
Sites not aligning to the query:
6i4yA X-ray structure of the human mitochondrial prelid3b-triap1 complex (see paper)
50% identity, 89% coverage: 31:381/395 of query aligns to 6:356/429 of 6i4yA
>WP_086508157.1 NCBI__GCF_002151265.1:WP_086508157.1
MHRTRHGVLLPVLVALGSGLAFSTYAFDGDRLTIWMGDNKGYDGIREVARQFADDTGIEV
RIVNPDNLTDRFQQAAGSGQGPDIVIWAHDRIGEWAQSGLLAPVSPSSDFRERYFDFTWD
ATLWSGEHYGYPISVEALGLIYNKALVETPPESFAELAQLDAELAEQGRKAILFDYGEPY
YGWTLLAANGGYPFRRTEEGFDVDDIGVNNEGALQGAELLVELIESGVLPRGTDYSIMDT
RFNRGEVAAMISGPWAWSNLEQSGIDYGVALLPKVGEERAKPMFGVMAAMINTASPNDFL
AVEFLENYLLSEEGMRTFNSDSTLGAVAHIAYQQELESDPNIAATLENAELGMPMPNIPE
MGAFWAAMEPALQNIGSGRQSPREALDAAARRMRQ
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory