SitesBLAST
Comparing WP_086508312.1 NCBI__GCF_002151265.1:WP_086508312.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P42412 Malonate-semialdehyde dehydrogenase; MSA dehydrogenase; Methylmalonate-semialdehyde dehydrogenase; MMSA dehydrogenase; MMSDH; MSDH; EC 1.2.1.27 from Bacillus subtilis (strain 168) (see 3 papers)
47% identity, 97% coverage: 3:486/499 of query aligns to 4:485/487 of P42412
- C36 (≠ A35) mutation to A: No effect at either the structural or enzymatic levels; when associated with A-160; A-287; A-351 and A-413.
- R107 (= R106) mutation to L: At least 50-fold decrease of the second-order rate constant for the acylation step.
- A150 (≠ T149) binding
- F152 (= F151) binding
- C160 (= C159) mutation to A: No effect at either the structural or enzymatic levels; when associated with A-36; A-287; A-351 and A-413.
- K176 (= K175) binding
- E179 (= E178) binding
- R180 (≠ Q179) binding
- S229 (= S228) binding
- T251 (≠ M250) binding
- R283 (= R282) mutation to L: At least 50-fold decrease of the second-order rate constant for the acylation step.
- C287 (≠ N286) mutation to A: No effect at either the structural or enzymatic levels; when associated with A-36; A-160; A-351 and A-413.
- C351 (≠ V349) mutation to A: No effect at either the structural or enzymatic levels; when associated with A-36; A-160; A-287 and A-413.
- E382 (= E383) binding
- C413 (≠ S414) mutation to A: No effect at either the structural or enzymatic levels; when associated with A-36; A-160; A-287 and A-351.
4zz7A Crystal structure of methylmalonate-semialdehyde dehydrogenase (dddc) from oceanimonas doudoroffii (see paper)
47% identity, 95% coverage: 10:482/499 of query aligns to 8:481/489 of 4zz7A
- active site: N149 (= N152), K172 (= K175), L246 (≠ M249), C280 (= C283), E382 (= E383), A462 (≠ P463)
- binding nicotinamide-adenine-dinucleotide: T146 (= T149), P147 (≠ A150), F148 (= F151), N149 (= N152), K172 (= K175), E175 (= E178), K205 (≠ P208), V208 (≠ A211), F222 (= F225), V223 (≠ I226), G224 (= G227), S225 (= S228), I228 (≠ V231), L246 (≠ M249), G247 (≠ M250), C280 (= C283), E382 (= E383), F384 (= F385)
1t90A Crystal structure of methylmalonate semialdehyde dehydrogenase from bacillus subtilis
47% identity, 97% coverage: 3:486/499 of query aligns to 2:483/484 of 1t90A
- active site: N151 (= N152), K174 (= K175), L248 (≠ M249), C282 (= C283), E380 (= E383), A460 (≠ P463)
- binding nicotinamide-adenine-dinucleotide: I147 (= I148), A148 (≠ T149), P149 (≠ A150), F150 (= F151), N151 (= N152), W159 (≠ F160), K174 (= K175), E177 (= E178), R178 (≠ Q179), H207 (≠ P208), V225 (≠ I226), G226 (= G227), S227 (= S228), V230 (= V231), L248 (≠ M249), T249 (≠ M250), C282 (= C283), E380 (= E383), F382 (= F385)
4iymC Crystal structure of putative methylmalonate-semialdehyde dehydrogenase from sinorhizobium meliloti 1021 complexed with NAD, target 011934
47% identity, 96% coverage: 3:482/499 of query aligns to 4:485/491 of 4iymC
- active site: N153 (= N152), K176 (= K175), F250 (≠ M249), C284 (= C283), E386 (= E383), Q466 (≠ P463)
- binding nicotinamide-adenine-dinucleotide: I149 (= I148), T150 (= T149), P151 (≠ A150), F152 (= F151), N153 (= N152), F154 (= F153), K176 (= K175), K209 (≠ P208), V212 (≠ A211), F226 (= F225), V227 (≠ I226), G228 (= G227), S229 (= S228), I232 (≠ V231), G251 (≠ M250), C284 (= C283), E386 (= E383), F388 (= F385)
5tjrD X-ray crystal structure of a methylmalonate semialdehyde dehydrogenase from pseudomonas sp. Aac (see paper)
49% identity, 92% coverage: 24:482/499 of query aligns to 20:455/468 of 5tjrD
- active site: N144 (= N152), K167 (= K175), L241 (≠ M249), C270 (= C283), E356 (= E383), A436 (≠ P463)
- binding adenosine-5'-diphosphate: I140 (= I148), T141 (= T149), F143 (= F151), K167 (= K175), E170 (= E178), K200 (≠ P208), F217 (= F225), S220 (= S228), I223 (≠ V231)
6wsbA Crystal structure of a betaine aldehyde dehydrogenase from burkholderia pseudomallei bound to cofactor NAD (see paper)
35% identity, 94% coverage: 8:478/499 of query aligns to 8:477/489 of 6wsbA
- active site: N152 (= N152), E250 (≠ M249), C284 (= C283), E462 (≠ P463)
- binding nicotinamide-adenine-dinucleotide: I148 (= I148), G149 (≠ T149), A150 (= A150), W151 (≠ F151), N152 (= N152), K175 (= K175), E178 (= E178), G208 (≠ P208), G211 (≠ A211), A212 (≠ N212), F225 (= F225), T226 (≠ I226), G227 (= G227), G228 (≠ S228), T231 (≠ V231), V235 (≠ I235), E250 (≠ M249), L251 (≠ M250), G252 (= G251), C284 (= C283), E385 (= E383), F387 (= F385)
5gtlA NADPH complex structure of aldehyde dehydrogenase from bacillus cereus
34% identity, 95% coverage: 4:478/499 of query aligns to 15:486/491 of 5gtlA
- active site: N165 (= N152), K188 (= K175), E263 (≠ M249), C297 (= C283), E394 (= E383), E471 (≠ P463)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: I161 (= I148), P163 (≠ A150), K188 (= K175), A190 (≠ S177), E191 (= E178), Q192 (= Q179), G221 (= G207), G225 (≠ A211), G241 (= G227), S242 (= S228), T245 (≠ V231), L264 (≠ M250), C297 (= C283), E394 (= E383), F396 (= F385)
5gtkA NAD+ complex structure of aldehyde dehydrogenase from bacillus cereus
34% identity, 95% coverage: 4:478/499 of query aligns to 15:486/491 of 5gtkA
- active site: N165 (= N152), K188 (= K175), E263 (≠ M249), C297 (= C283), E394 (= E383), E471 (≠ P463)
- binding nicotinamide-adenine-dinucleotide: I161 (= I148), I162 (≠ T149), P163 (≠ A150), W164 (≠ F151), K188 (= K175), E191 (= E178), G221 (= G207), G225 (≠ A211), A226 (≠ N212), F239 (= F225), G241 (= G227), S242 (= S228), T245 (≠ V231), Y248 (≠ H234), L264 (≠ M250), C297 (= C283), Q344 (≠ A329), R347 (= R332), E394 (= E383), F396 (= F385)
8skfA Crystal structure of betaine aldehyde dehydrogenase (betb) from klebsiella aerogenes (lattice translocation disorder)
35% identity, 95% coverage: 5:478/499 of query aligns to 13:486/497 of 8skfA
- binding calcium ion: T33 (≠ V25), I34 (= I26), D100 (≠ E92), V187 (≠ Q179)
- binding nicotinamide-adenine-dinucleotide: I156 (= I148), G157 (≠ T149), A158 (= A150), W159 (≠ F151), K183 (= K175), E186 (= E178), G216 (= G207), G220 (≠ A211), T235 (≠ I226), G236 (= G227), G237 (≠ S228), S240 (≠ V231), K243 (≠ H234), E259 (≠ M249), C293 (= C283), F396 (= F385)
8vr1A Crystal structure of betaine aldehyde dehydrogenase (betb) from klebsiella aerogenes (ctp bound)
35% identity, 95% coverage: 5:478/499 of query aligns to 4:477/488 of 8vr1A
8vr0A Crystal structure of betaine aldehyde dehydrogenase (betb) from klebsiella aerogenes (gmp bound)
35% identity, 95% coverage: 5:478/499 of query aligns to 4:477/488 of 8vr0A
8vqzA Crystal structure of betaine aldehyde dehydrogenase (betb) from klebsiella aerogenes (cmp bound)
35% identity, 95% coverage: 5:478/499 of query aligns to 4:477/488 of 8vqzA
8vqwC Crystal structure of betaine aldehyde dehydrogenase (betb) from klebsiella aerogenes (coa bound)
35% identity, 95% coverage: 5:478/499 of query aligns to 4:477/488 of 8vqwC
- binding coenzyme a: I147 (= I148), W150 (≠ F151), K174 (= K175), S176 (= S177), E177 (= E178), G207 (= G207), G211 (≠ A211), F225 (= F225), G227 (= G227), G228 (≠ S228), S231 (≠ V231), H331 (≠ A329), F387 (= F385)
8vj3A Crystal structure of betaine aldehyde dehydrogenase (betb) from klebsiella aerogenes (fad bound)
35% identity, 95% coverage: 5:478/499 of query aligns to 4:477/488 of 8vj3A
8uzoA Crystal structure of betaine aldehyde dehydrogenase (betb) from klebsiella aerogenes (adp bound)
35% identity, 95% coverage: 5:478/499 of query aligns to 4:477/488 of 8uzoA
8uznA Crystal structure of betaine aldehyde dehydrogenase (betb) from klebsiella aerogenes (amp bound)
35% identity, 95% coverage: 5:478/499 of query aligns to 4:477/488 of 8uznA
- binding adenosine monophosphate: I147 (= I148), G148 (≠ T149), K174 (= K175), S176 (= S177), E177 (= E178), G207 (= G207), G211 (≠ A211), F225 (= F225), G228 (≠ S228), S231 (≠ V231), K234 (≠ H234)
8uzmA Crystal structure of betaine aldehyde dehydrogenase (betb) from klebsiella aerogenes (NADPH bound)
35% identity, 95% coverage: 5:478/499 of query aligns to 4:477/488 of 8uzmA
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G148 (≠ T149), W150 (≠ F151), K174 (= K175), S176 (= S177), E177 (= E178), G207 (= G207), G211 (≠ A211), F225 (= F225), T226 (≠ I226), G227 (= G227), G228 (≠ S228), S231 (≠ V231), E250 (≠ M249), G252 (= G251), C284 (= C283), E385 (= E383), F387 (= F385)
8uzkA Crystal structure of betaine aldehyde dehydrogenase (betb) from klebsiella aerogenes (NADP+ bound)
35% identity, 95% coverage: 5:478/499 of query aligns to 4:477/488 of 8uzkA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: I147 (= I148), G148 (≠ T149), W150 (≠ F151), N151 (= N152), K174 (= K175), S176 (= S177), E177 (= E178), G207 (= G207), G211 (≠ A211), F225 (= F225), G227 (= G227), G228 (≠ S228), S231 (≠ V231), E250 (≠ M249), F387 (= F385)
2opxA Crystal structure of lactaldehyde dehydrogenase from escherichia coli
33% identity, 95% coverage: 7:478/499 of query aligns to 6:473/477 of 2opxA
- active site: N151 (= N152), K174 (= K175), E249 (≠ M249), C283 (= C283), E381 (= E383), A458 (≠ P463)
- binding (3alpha,5beta,12alpha)-3,12-dihydroxycholan-24-oic acid: F105 (≠ R106), F152 (= F153), N284 (vs. gap), F312 (≠ V311), G313 (= G312), R318 (≠ Q316), D320 (= D318), I321 (≠ A319), A322 (≠ D320), Y362 (≠ F364), F440 (≠ P442), F440 (≠ P442), E441 (≠ V443)
2impA Crystal structure of lactaldehyde dehydrogenase from e. Coli: the ternary complex with lactate (occupancy 0.5) and nadh. Crystals soaked with (l)-lactate. (see paper)
33% identity, 95% coverage: 7:478/499 of query aligns to 6:473/477 of 2impA
- active site: N151 (= N152), K174 (= K175), E249 (≠ M249), C283 (= C283), E381 (= E383), A458 (≠ P463)
- binding 1,4-dihydronicotinamide adenine dinucleotide: I147 (= I148), L148 (≠ T149), P149 (≠ A150), W150 (≠ F151), K174 (= K175), E177 (= E178), F178 (≠ Q179), G207 (= G207), G211 (≠ A211), Q212 (≠ N212), S228 (= S228), A231 (≠ V231), K234 (≠ H234), R334 (= R332)
Query Sequence
>WP_086508312.1 NCBI__GCF_002151265.1:WP_086508312.1
MSIREIPMYIDGQAVPSQSQEWRDVINPATQEVVARVPFCTAEEVDRAVASAKEAFKTWR
KTPLAKRMRIMLTLQALIREHTEELAALITEEHGKTLPDAAGEVGRGLEVVEHACSITSL
QLGELAENAANEVDVYTLNQPLGVGAGITAFNFPIMLPCFMFPLAIATGNTFVLKPSEQD
PSSTMRLVELAHEAGVPAGVLNVVHGGPDVANQICDHPDIKALSFIGSTNVGTHIYRRAS
EAGKRVQSMMGAKNHCVVMPDANRSQAINNLLGSAFGAAGQRCMANSVVVLVGEANQWLD
DIVEGARNMKVGPGTQRDADLGPLVSKAARDRVVRLIDAGEKEGARLLVDGRGYQVEGYP
DGNFVGATVFADVKPEMTIYREEIFGPVLCVVSVDTLDEAIAFINANPNGNGTSIFTNSG
WVARRFETDIDVGQVGINVPIPVPVAYFSFTGSRGSKLGDLGPNGKQAIQFWTQTKTVTA
RWFEPENVSSGINSTISLS
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory