Comparing WP_086508434.1 NCBI__GCF_002151265.1:WP_086508434.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6io1B Crystal structure of a novel thermostable (s)-enantioselective omega- transaminase from thermomicrobium roseum (see paper)
40% identity, 90% coverage: 21:425/450 of query aligns to 38:436/448 of 6io1B
Sites not aligning to the query:
5lhaA Amine transaminase crystal structure from an uncultivated pseudomonas species in the pmp-bound form
37% identity, 93% coverage: 17:434/450 of query aligns to 28:445/447 of 5lhaA
5lh9D Amine transaminase crystal structure from an uncultivated pseudomonas species in the plp-bound (internal aldimine) form
37% identity, 93% coverage: 17:434/450 of query aligns to 30:447/449 of 5lh9D
6fyqA The crystal structure of a new transaminase from the marine bacterium virgibacillus (see paper)
35% identity, 93% coverage: 22:439/450 of query aligns to 35:442/443 of 6fyqA
Sites not aligning to the query:
6s54A Transaminase from pseudomonas fluorescens (see paper)
35% identity, 92% coverage: 17:432/450 of query aligns to 34:448/453 of 6s54A
Sites not aligning to the query:
3du4A Crystal structure of 7-keto-8-aminopelargonic acid bound 7,8- diaminopelargonic acid synthase in bacillus subtilis (see paper)
32% identity, 95% coverage: 8:434/450 of query aligns to 23:442/448 of 3du4A
Sites not aligning to the query:
P53555 L-Lysine--8-amino-7-oxononanoate transaminase; 7,8-diamino-pelargonic acid aminotransferase; DAPA AT; DAPA aminotransferase; 7,8-diaminononanoate synthase; DANS; Diaminopelargonic acid synthase; L-Lysine--8-amino-7-oxononanoate aminotransferase; EC 2.6.1.105 from Bacillus subtilis (strain 168) (see paper)
32% identity, 95% coverage: 8:434/450 of query aligns to 23:442/448 of P53555
4a6rA Crystal structure of the omega transaminase from chromobacterium violaceum in the apo form, crystallised from polyacrylic acid (see paper)
35% identity, 94% coverage: 17:441/450 of query aligns to 3:419/423 of 4a6rA
7q9xAAA Probable aminotransferase
35% identity, 94% coverage: 17:441/450 of query aligns to 32:451/455 of 7q9xAAA
4a6tC Crystal structure of the omega transaminase from chromobacterium violaceum in complex with plp (see paper)
35% identity, 94% coverage: 17:441/450 of query aligns to 32:451/455 of 4a6tC
Sites not aligning to the query:
6s4gA Crystal structure of the omega transaminase from chromobacterium violaceum in complex with pmp (see paper)
35% identity, 94% coverage: 17:441/450 of query aligns to 31:450/453 of 6s4gA
Sites not aligning to the query:
4ba5A Crystal structure of omega-transaminase from chromobacterium violaceum (see paper)
35% identity, 94% coverage: 17:441/450 of query aligns to 4:423/427 of 4ba5A
6gwiB The crystal structure of halomonas elongata amino-transferase (see paper)
34% identity, 94% coverage: 17:439/450 of query aligns to 32:449/450 of 6gwiB
Sites not aligning to the query:
Q94CE5 Gamma-aminobutyrate transaminase POP2, mitochondrial; AtGABA-T; Gamma-aminobutyric acid aminotransferase 1; Protein HEXENAL RESPONSE 1; Protein POLLEN-PISTIL INCOMPATIBILITY 2; AtPOP2; EC 2.6.1.96 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
31% identity, 94% coverage: 17:439/450 of query aligns to 73:495/504 of Q94CE5
6zhkA Crystal structure of adenosylmethionine-8-amino-7-oxononanoate aminotransferase from methanocaldococcus jannaschii dsm 2661
33% identity, 93% coverage: 17:436/450 of query aligns to 31:437/438 of 6zhkA
Sites not aligning to the query:
6wnnA Bacillus subtilis bioa in complex with amino donor l-lys
31% identity, 95% coverage: 8:434/450 of query aligns to 20:414/420 of 6wnnA
Sites not aligning to the query:
7ypmA Crystal structure of transaminase cc1012 complexed with plp and l- alanine (see paper)
34% identity, 92% coverage: 17:432/450 of query aligns to 33:444/454 of 7ypmA
7ypnD Crystal structure of transaminase cc1012 mutant m9 complexed with plp (see paper)
34% identity, 92% coverage: 17:432/450 of query aligns to 33:444/455 of 7ypnD
D6R3B6 Vanillin aminotransferase; Putative aminotransferase; pAMT; EC 2.6.1.119 from Capsicum frutescens (Cayenne pepper) (Tabasco pepper) (see paper)
32% identity, 94% coverage: 17:439/450 of query aligns to 30:451/459 of D6R3B6
3dodA Crystal structure of plp bound 7,8-diaminopelargonic acid synthase in bacillus subtilis (see paper)
31% identity, 95% coverage: 8:434/450 of query aligns to 21:411/417 of 3dodA
Sites not aligning to the query:
>WP_086508434.1 NCBI__GCF_002151265.1:WP_086508434.1
MDPSHLFYQAGPALPEVSHAKGVYLWDETGRQYLDGCSGAISCNLGHGRNDIREAMLAQL
DRVAFTYRTQFENAPAVALAKALVGFTQQQLEKVFFVSSGSEAVESALKLARQYFVARGE
PQRRRFVSLRPSYHGSTLGALGVTGYQPLEAPFRDIAIGSLKVAGPDFYRHDDTDDGRHV
ARVLADTRAAIEAAGPDTIAAFVLEPVGGASTGARKLDRSYLAGIRALCDEFGCLLILDE
VLTGIGRTGTWFAYQHYGVTPDLLSTAKGLGAGYYPVGAVLSRADIVETVMASGGFQHGH
TYAGNPLACATGLAVVEAIEREKILDNVAARGRQLAAGLEALKARFPWVGDVRGLGLLWG
VELVADAASKAPFPAEQNRFARITALAREEGLLIYPRRTLDGIAGDHFLITPPLTIDAAD
TAELLTRLERAMQRFDREVPAATPMNATTL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory