Comparing WP_086508437.1 NCBI__GCF_002151265.1:WP_086508437.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3pfoA Crystal structure of a putative acetylornithine deacetylase (rpa2325) from rhodopseudomonas palustris cga009 at 1.90 a resolution
35% identity, 95% coverage: 5:416/432 of query aligns to 6:420/426 of 3pfoA
7uoiA Crystallographic structure of dape from enterococcus faecium
28% identity, 78% coverage: 80:416/432 of query aligns to 53:381/383 of 7uoiA
5vo3A Crystal structure of dape in complex with the products (succinic acid and diaminopimelic acid) (see paper)
22% identity, 90% coverage: 15:402/432 of query aligns to 4:364/380 of 5vo3A
P44514 Succinyl-diaminopimelate desuccinylase; SDAP desuccinylase; N-succinyl-LL-2,6-diaminoheptanedioate amidohydrolase; EC 3.5.1.18 from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) (see 3 papers)
22% identity, 90% coverage: 16:402/432 of query aligns to 1:360/377 of P44514
7lgpB Dape enzyme from shigella flexneri
26% identity, 73% coverage: 94:409/432 of query aligns to 60:368/377 of 7lgpB
7rsfA Acetylornithine deacetylase from escherichia coli
28% identity, 55% coverage: 64:300/432 of query aligns to 44:271/380 of 7rsfA
4pqaA Crystal structure of succinyl-diaminopimelate desuccinylase from neisseria meningitidis mc58 in complex with the inhibitor captopril (see paper)
26% identity, 52% coverage: 88:312/432 of query aligns to 53:279/375 of 4pqaA
Sites not aligning to the query:
4o23A Crystal structure of mono-zinc form of succinyl diaminopimelate desuccinylase from neisseria meningitidis mc58 (see paper)
26% identity, 52% coverage: 88:312/432 of query aligns to 53:279/376 of 4o23A
4op4B Crystal structure of the catalytic domain of dape protein from v.Cholerea in the zn bound form (see paper)
54% identity, 13% coverage: 95:148/432 of query aligns to 60:113/265 of 4op4B
Sites not aligning to the query:
4h2kA Crystal structure of the catalytic domain of succinyl-diaminopimelate desuccinylase from haemophilus influenzae (see paper)
25% identity, 43% coverage: 15:198/432 of query aligns to 2:170/258 of 4h2kA
Sites not aligning to the query:
7t1qA Crystal structure of the succinyl-diaminopimelate desuccinylase (dape) from acinetobacter baumannii in complex with succinic acid
27% identity, 51% coverage: 92:312/432 of query aligns to 57:279/377 of 7t1qA
Sites not aligning to the query:
3dljA Crystal structure of human carnosine dipeptidase 1
38% identity, 25% coverage: 84:193/432 of query aligns to 83:197/471 of 3dljA
Sites not aligning to the query:
Q96KN2 Beta-Ala-His dipeptidase; CNDP dipeptidase 1; Carnosine dipeptidase 1; Glutamate carboxypeptidase-like protein 2; Serum carnosinase; EC 3.4.13.20 from Homo sapiens (Human) (see 4 papers)
38% identity, 25% coverage: 84:193/432 of query aligns to 114:228/507 of Q96KN2
Sites not aligning to the query:
Q96KP4 Cytosolic non-specific dipeptidase; CNDP dipeptidase 2; Glutamate carboxypeptidase-like protein 1; Peptidase A; Threonyl dipeptidase; EC 3.4.13.18 from Homo sapiens (Human)
35% identity, 20% coverage: 84:168/432 of query aligns to 81:163/475 of Q96KP4
Sites not aligning to the query:
Q9D1A2 Cytosolic non-specific dipeptidase; CNDP dipeptidase 2; Glutamate carboxypeptidase-like protein 1; Threonyl dipeptidase; EC 3.4.13.18 from Mus musculus (Mouse) (see 2 papers)
35% identity, 20% coverage: 84:168/432 of query aligns to 81:163/475 of Q9D1A2
Sites not aligning to the query:
2zogA Crystal structure of mouse carnosinase cn2 complexed with zn and bestatin (see paper)
35% identity, 20% coverage: 84:168/432 of query aligns to 85:167/478 of 2zogA
Sites not aligning to the query:
2zofA Crystal structure of mouse carnosinase cn2 complexed with mn and bestatin (see paper)
35% identity, 20% coverage: 84:168/432 of query aligns to 85:167/478 of 2zofA
Sites not aligning to the query:
P37111 Aminoacylase-1; ACY-1; N-acyl-L-amino-acid amidohydrolase; EC 3.5.1.14 from Sus scrofa (Pig) (see paper)
27% identity, 43% coverage: 97:281/432 of query aligns to 75:266/407 of P37111
Sites not aligning to the query:
5k8nA 5naa-bound 5-nitroanthranilate aminohydrolase (see paper)
27% identity, 26% coverage: 81:193/432 of query aligns to 60:191/420 of 5k8nA
Sites not aligning to the query:
5k8pA Zn2+/tetrahedral intermediate-bound r289a 5-nitroanthranilate aminohydrolase (see paper)
27% identity, 26% coverage: 81:193/432 of query aligns to 61:192/421 of 5k8pA
Sites not aligning to the query:
>WP_086508437.1 NCBI__GCF_002151265.1:WP_086508437.1
MLSDIEQRIVERCEALLDDTLALTCDLVRGYSVLGREHGALETMERWFERLELPVTRVPL
DAPGFAAHAHRVPTEWDCAGRYNLVAQLNADSPGPHLVFNGHLDVVPAEPTDMWTRLPWE
PWEKDGWLYGRGAGDMKAGIAAMTLAVQAVRQAGVVIDFPLTLQTVIEEECTGNGALACL
HQGFSGDFVLIPEPFGARIYAGQVGVLWFRMRLDGVPAHVLDTRAGRNAIETLIEYLPAF
KALEAEINGLPRQAPYDALDSPFNLSIGKIEGGNWASSVPAHAILEGRVGFPPGMTPDEV
MERVRHCVATRHAELADAGPAPRVEFHGFRSEGHLVDLEAPGIELLSRCHQDLLGEPPAT
YLSTCTTDLRAFHVSGAINGTCYGPVAQRIHGVDECVEIDSIRHVLTTYALFIHRWAEMA
RTMGTRTRGDRS
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory