Comparing WP_086508441.1 NCBI__GCF_002151265.1:WP_086508441.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4zv1A An ancestral arginine-binding protein bound to arginine (see paper)
37% identity, 79% coverage: 52:259/264 of query aligns to 14:226/226 of 4zv1A
Sites not aligning to the query:
4zv2A An ancestral arginine-binding protein bound to glutamine (see paper)
38% identity, 79% coverage: 52:259/264 of query aligns to 14:224/225 of 4zv2A
Sites not aligning to the query:
3vv5A Crystal structure of ttc0807 complexed with (s)-2-aminoethyl-l- cysteine (aec) (see paper)
39% identity, 81% coverage: 50:262/264 of query aligns to 21:234/237 of 3vv5A
Sites not aligning to the query:
3vvfA Crystal structure of ttc0807 complexed with arginine (see paper)
39% identity, 81% coverage: 50:262/264 of query aligns to 25:238/241 of 3vvfA
Sites not aligning to the query:
3vveA Crystal structure of ttc0807 complexed with lysine (see paper)
39% identity, 81% coverage: 50:262/264 of query aligns to 25:238/241 of 3vveA
Sites not aligning to the query:
3vvdA Crystal structure of ttc0807 complexed with ornithine (see paper)
39% identity, 81% coverage: 50:262/264 of query aligns to 25:238/241 of 3vvdA
Sites not aligning to the query:
5t0wA Crystal structure of the ancestral amino acid-binding protein anccdt- 1, a precursor of cyclohexadienyl dehydratase
33% identity, 78% coverage: 52:258/264 of query aligns to 20:228/229 of 5t0wA
Sites not aligning to the query:
3tqlA Structure of the amino acid abc transporter, periplasmic amino acid- binding protein from coxiella burnetii. (see paper)
38% identity, 82% coverage: 42:258/264 of query aligns to 2:225/225 of 3tqlA
2ylnA Crystal structure of the l-cystine solute receptor of neisseria gonorrhoeae in the closed conformation (see paper)
31% identity, 84% coverage: 43:263/264 of query aligns to 15:238/240 of 2ylnA
P0AEU0 Histidine-binding periplasmic protein; HBP from Escherichia coli (strain K12) (see 3 papers)
29% identity, 80% coverage: 52:262/264 of query aligns to 36:257/260 of P0AEU0
Sites not aligning to the query:
4kqpA Crystal structure of lactococcus lactis glnp substrate binding domain 2 (sbd2) in complex with glutamine at 0.95 a resolution (see paper)
30% identity, 85% coverage: 37:261/264 of query aligns to 1:229/230 of 4kqpA
P02910 Histidine-binding periplasmic protein; HBP from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see 2 papers)
29% identity, 80% coverage: 52:262/264 of query aligns to 36:257/260 of P02910
Sites not aligning to the query:
1hslA Refined 1.89 angstroms structure of the histidine-binding protein complexed with histidine and its relationship with many other active transport(slash)chemosensory receptors (see paper)
29% identity, 80% coverage: 52:262/264 of query aligns to 14:235/238 of 1hslA
2q2cA Crystal structures of the arginine-, lysine-, histidine-binding protein artj from the thermophilic bacterium geobacillus stearothermophilus (see paper)
31% identity, 80% coverage: 52:261/264 of query aligns to 11:223/231 of 2q2cA
2pvuA Crystal structures of the arginine-, lysine-, histidine-binding protein artj from the thermophilic bacterium geobacillus stearothermophilus (see paper)
31% identity, 80% coverage: 52:261/264 of query aligns to 15:227/235 of 2pvuA
4ymxA Crystal structure of the substrate binding protein of an amino acid abc transporter (see paper)
30% identity, 79% coverage: 52:260/264 of query aligns to 11:224/224 of 4ymxA
Sites not aligning to the query:
2q2aA Crystal structures of the arginine-, lysine-, histidine-binding protein artj from the thermophilic bacterium geobacillus stearothermophilus (see paper)
31% identity, 80% coverage: 52:261/264 of query aligns to 21:233/241 of 2q2aA
Sites not aligning to the query:
4g4pA Crystal structure of glutamine-binding protein from enterococcus faecalis at 1.5 a (see paper)
29% identity, 83% coverage: 40:257/264 of query aligns to 12:233/235 of 4g4pA
8eyzA Engineered glutamine binding protein bound to gln and a cobaloxime ligand (see paper)
31% identity, 79% coverage: 52:259/264 of query aligns to 13:222/226 of 8eyzA
Sites not aligning to the query:
6svfA Crystal structure of the p235gk mutant of argbp from t. Maritima (see paper)
33% identity, 81% coverage: 46:258/264 of query aligns to 11:227/229 of 6svfA
>WP_086508441.1 NCBI__GCF_002151265.1:WP_086508441.1
MNNTLRSLFATTFSTALATTATLAVVATATLLPVSEARAEQETFTYAMTGLYPPFSYREN
GKLAGFDVDIGRALAEEMGMTAEPVANPWQTLIAALRSNRFDAIIGSMAITEARQEQVDF
TDPYYSSGAQVFISANNGELHEVEDIRGKTLGVLVASSFADAAREYSDDLTTYTDDVTAL
RDLTVRGRVDAVITDQLIGENAIHNANLPVQPLGEPIYVDDIGIAVNKGNEELLERLNEA
LAAIKANGRYAEISERYFGRDISQ
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory