Comparing WP_086508611.1 NCBI__GCF_002151265.1:WP_086508611.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2xuaH Crystal structure of the enol-lactonase from burkholderia xenovorans lb400 (see paper)
32% identity, 67% coverage: 1:266/399 of query aligns to 1:259/261 of 2xuaH
4uhfA Structural studies of a thermophilic esterase from thermogutta terrifontis (l37a mutant with butyrate bound) (see paper)
24% identity, 63% coverage: 24:276/399 of query aligns to 28:277/278 of 4uhfA
4uheA Structural studies of a thermophilic esterase from thermogutta terrifontis (malate bound) (see paper)
24% identity, 61% coverage: 24:266/399 of query aligns to 28:267/272 of 4uheA
4uhdA Structural studies of a thermophilic esterase from thermogutta terrifontis (acetate bound) (see paper)
24% identity, 61% coverage: 24:266/399 of query aligns to 28:267/274 of 4uhdA
5z7wB Crystal structure of striga hermonthica htl1 (shhtl1) (see paper)
24% identity, 62% coverage: 17:263/399 of query aligns to 18:263/271 of 5z7wB
6i8wB Crystal structure of a membrane phospholipase a, a novel bacterial virulence factor (see paper)
24% identity, 71% coverage: 4:286/399 of query aligns to 45:309/310 of 6i8wB
Sites not aligning to the query:
5z89A Structural basis for specific inhibition of highly sensitive shhtl7 receptor (see paper)
22% identity, 63% coverage: 24:275/399 of query aligns to 18:268/268 of 5z89A
7c8lA Hybrid designing of potent inhibitors of striga strigolactone receptor shhtl7 (see paper)
22% identity, 63% coverage: 24:275/399 of query aligns to 18:268/268 of 7c8lA
7snuA Crystal structure of shhtl7 from striga hermonthica in complex with strigolactone antagonist rg6 (see paper)
23% identity, 58% coverage: 24:255/399 of query aligns to 21:254/270 of 7snuA
5z7yA Crystal structure of striga hermonthica htl7 (shhtl7) (see paper)
23% identity, 58% coverage: 24:255/399 of query aligns to 19:252/267 of 5z7yA
Q9SQR3 Strigolactone esterase D14; Protein DWARF 14; AtD14; EC 3.1.-.- from Arabidopsis thaliana (Mouse-ear cress) (see 4 papers)
24% identity, 60% coverage: 23:262/399 of query aligns to 21:261/267 of Q9SQR3
4b9eA Structure of a putative epoxide hydrolase from pseudomonas aeruginosa, with bound mfa. (see paper)
30% identity, 27% coverage: 22:129/399 of query aligns to 28:135/297 of 4b9eA
Sites not aligning to the query:
5dnuA Crystal structure of striga kai2-like protein in complex with karrikin (see paper)
23% identity, 62% coverage: 24:269/399 of query aligns to 18:265/267 of 5dnuA
7p4kA Soluble epoxide hydrolase in complex with fl217 (see paper)
30% identity, 28% coverage: 22:132/399 of query aligns to 31:141/313 of 7p4kA
Sites not aligning to the query:
8qn0A Soluble epoxide hydrolase in complex with rk3 (see paper)
30% identity, 28% coverage: 22:132/399 of query aligns to 34:144/322 of 8qn0A
Sites not aligning to the query:
8qzdA Soluble epoxide hydrolase in complex with epoxykinin (see paper)
30% identity, 28% coverage: 22:132/399 of query aligns to 32:142/320 of 8qzdA
Sites not aligning to the query:
8qmzA Soluble epoxide hydrolase in complex with rk4 (see paper)
30% identity, 28% coverage: 22:132/399 of query aligns to 32:142/320 of 8qmzA
Sites not aligning to the query:
7ebaA Co-crystal of kurarinone with seh (see paper)
30% identity, 28% coverage: 22:132/399 of query aligns to 29:139/316 of 7ebaA
Sites not aligning to the query:
6i5gA X-ray structure of human soluble epoxide hydrolasE C-terminal domain (hseh ctd)in complex with 15d-pgj2 (see paper)
30% identity, 28% coverage: 22:132/399 of query aligns to 30:140/316 of 6i5gA
Sites not aligning to the query:
6yl4A Soluble epoxide hydrolase in complex with 3-((r)-3-(1-hydroxyureido) but-1-yn-1-yl)-n-((s)-3-phenyl-3-(4-trifluoromethoxy)phenyl)propyl) benzamide (see paper)
30% identity, 28% coverage: 22:132/399 of query aligns to 31:141/319 of 6yl4A
Sites not aligning to the query:
>WP_086508611.1 NCBI__GCF_002151265.1:WP_086508611.1
MAFLNVDGRSVAYRLLGPEALPLVVLAHPLGMSQAVWDELLPALLPRYRVLTWDLPGHGA
SQAWPAEGGEITPAALAREALALVEHAGVSRFHFVGTSIGGVVGQQLISEHAERLYSITL
TNTGAVIGNAELWSTRAERIRQEGLAAMAEEIVPRWFAPACFEAEPALKAGWCTQMGRGD
DESYARLCEMLGRTDFRGKLKGPLAEHPDIGVHLLGGSADVATPPETLQALAAECGGAPL
EILEGIAHVPSVEAPAAMAKRLLLWMASEREDVGEHGVSYADGLETRKQVLGEEHVARAS
RNANSLDAPFQQMITRLAWGELWSNDDLTRRERSLITTGILAALGREELVLHLKTAKRIG
LSEAELRQVLMHVAIYAGVPAANHAFALAKELGWGEELG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory