Comparing WP_086508614.1 NCBI__GCF_002151265.1:WP_086508614.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 5 hits to proteins with known functional sites (download)
Q0S7P9 Cholesterol ring-cleaving hydrolase IpdA subunit; (3E)-2-(2-carboxylatoethyl)-3-methyl-6-oxocyclohex-1-ene-1-carboxyl-CoA hydrolase alpha subunit; COCHEA-CoA hydrolase alpha subunit; EC 4.1.99.- from Rhodococcus jostii (strain RHA1) (see paper)
25% identity, 89% coverage: 5:251/276 of query aligns to 9:259/296 of Q0S7P9
6co9A Crystal structure of rhodococcus jostii rha1 ipdab cochea-coa complex (see paper)
25% identity, 89% coverage: 5:251/276 of query aligns to 8:258/295 of 6co9A
8i3yA Crystal structure of asct from trypanosoma brucei in complex with succinyl-coa.
27% identity, 83% coverage: 1:230/276 of query aligns to 2:236/459 of 8i3yA
Sites not aligning to the query:
8i40A Crystal structure of asct from trypanosoma brucei in complex with coa.
27% identity, 83% coverage: 1:230/276 of query aligns to 2:236/467 of 8i40A
Sites not aligning to the query:
8i3yD Crystal structure of asct from trypanosoma brucei in complex with succinyl-coa.
27% identity, 83% coverage: 1:230/276 of query aligns to 2:236/471 of 8i3yD
>WP_086508614.1 NCBI__GCF_002151265.1:WP_086508614.1
MAEFLSLRDAVARYVEDGATVAMEGFTHLIPFAAGHEVIRQKKRDLTLIRMTPDLVYDQM
IGAGCARKVIFSWGGNPGVGSLHRLRDAVEKGWPHKVEILEHSHAAMACAFEAGAAGLPL
AVLRGYVGSELPSVNDQIKFIECPFTGERLAAVPAVRPDVSIVHAQKADRAGNVLVEGIV
GVQKEAVLAAKQSIVTVEEIVDDLRAEADYHPNACIIPGWAISAIAVAEKGSLPSYAHGY
YPRNNAFYKEWDGIARDRDTFTRWIEENVMKAGGNA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory