Comparing WP_086508696.1 NCBI__GCF_002151265.1:WP_086508696.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 7 hits to proteins with known functional sites (download)
7wxiA Gpr domain of drosophila p5cs filament with glutamate and atpgammas (see paper)
40% identity, 93% coverage: 25:427/433 of query aligns to 5:406/430 of 7wxiA
7wxgA Gpr domain closed form of drosophila p5cs filament with glutamate, atp, and NADPH (see paper)
40% identity, 93% coverage: 25:427/433 of query aligns to 5:406/430 of 7wxgA
4jbeB 1.95 angstrom crystal structure of gamma-glutamyl phosphate reductase from saccharomonospora viridis.
35% identity, 92% coverage: 27:426/433 of query aligns to 13:408/412 of 4jbeB
5j7iC Crystal structure of a geobacillus thermoglucosidasius acetylating aldehyde dehydrogenase in complex with adp (see paper)
24% identity, 67% coverage: 124:414/433 of query aligns to 101:425/455 of 5j7iC
5j7iB Crystal structure of a geobacillus thermoglucosidasius acetylating aldehyde dehydrogenase in complex with adp (see paper)
24% identity, 67% coverage: 124:414/433 of query aligns to 102:426/456 of 5j7iB
3rhhD Crystal structure of NADP-dependent glyceraldehyde-3-phosphate dehydrogenase from bacillus halodurans c-125 complexed with NADP
26% identity, 63% coverage: 129:399/433 of query aligns to 142:456/480 of 3rhhD
4yweA Crystal structure of a putative aldehyde dehydrogenase from burkholderia cenocepacia
29% identity, 42% coverage: 114:297/433 of query aligns to 120:303/476 of 4yweA
Sites not aligning to the query:
>WP_086508696.1 NCBI__GCF_002151265.1:WP_086508696.1
MTAHASQTETSVNQIDDVVAYMAGLGQAARVAATQMRRAVTGDKNRALLAMAAHLQRRRS
EILEANAADLARGRASGLEAALLDRLALNDARIDAMIEGLEQVAALPDPVGEIEGLRYRP
SGIQVGQMRVPLGVIGIIYESRPNVTMEAASLCLKSGNASILRGGSEARDSNAAIAACIR
DGLRDAGLPETAVQVVATTDRAAVGQLIAMPEYVDVIIPRGGKSLIERISREARVPVIKH
LDGVCHVYIDATADPEKALAIAVNAKTHRYGTCNTMETLLVDAPVAEALLPRLAQAYAAH
GVELRGCERSRAILDDIAAASEEDWYAEYLAPVLAVRVVDGMEAAIEHIERYGSHHTDAI
VTEDYGLARRFMAEVDSSSVMVNASTRFADGFEYGLGAEIGISTDKLHARGPVGLEGLTT
RKYVVLGDGQVRQ
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory