SitesBLAST
Comparing WP_086508767.1 NCBI__GCF_002151265.1:WP_086508767.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1a05A Crystal structure of the complex of 3-isopropylmalate dehydrogenase from thiobacillus ferrooxidans with 3-isopropylmalate (see paper)
66% identity, 99% coverage: 3:357/359 of query aligns to 2:355/357 of 1a05A
Q56268 3-isopropylmalate dehydrogenase; 3-IPM-DH; Beta-IPM dehydrogenase; IMDH; EC 1.1.1.85 from Acidithiobacillus ferrooxidans (Thiobacillus ferrooxidans) (see paper)
66% identity, 99% coverage: 3:357/359 of query aligns to 2:355/358 of Q56268
- R95 (= R96) binding
- R105 (= R106) binding
- R133 (= R134) binding
- D222 (= D223) binding ; binding
- D246 (= D247) binding
4xxvA Crystal structure of 3-isopropylmalate dehydrogenase from burkholderia thailandensis in complex with NAD
66% identity, 98% coverage: 4:356/359 of query aligns to 3:356/356 of 4xxvA
4iwhA Crystal structure of a 3-isopropylmalate dehydrogenase from burkholderia pseudomallei
66% identity, 98% coverage: 4:356/359 of query aligns to 5:358/358 of 4iwhA
P93832 3-isopropylmalate dehydrogenase 2, chloroplastic; 3-IPM-DH 2; AtIMDH2; AtIMDH3; IMDH 2; Beta-IPM dehydrogenase 2; Isopropylmalate dehydrogenase 2; AtIMD2; EC 1.1.1.85 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
61% identity, 99% coverage: 5:358/359 of query aligns to 45:399/405 of P93832
- 114:129 (vs. 73:89, 53% identical) binding
- L132 (= L92) mutation to A: Reduced activity toward 3-isopropylmalate.
- L133 (= L93) Confers substrate specificity; mutation to A: Reduced activity toward 3-isopropylmalate.; mutation to F: Enhanced activity toward 3-(2'-methylthio)-ethylmalate, but reduced catalytic efficiency with 3-isopropylmalate.
- R136 (= R96) binding ; mutation to A: Loss of activity toward 3-isopropylmalate.; mutation to K: Reduced activity toward 3-isopropylmalate.
- R146 (= R106) binding ; mutation to A: Reduced activity toward 3-isopropylmalate.; mutation to K: Reduced activity toward 3-isopropylmalate.
- R174 (= R134) binding ; mutation to A: Loss of activity toward 3-isopropylmalate.; mutation to K: Reduced activity toward 3-isopropylmalate.
- Y181 (= Y141) Important for catalysis; mutation Y->A,F,H: Reduced activity toward 3-isopropylmalate.
- K232 (= K191) Important for catalysis; mutation to M: Loss of activity toward 3-isopropylmalate.
- N234 (= N193) binding ; mutation N->A,D: Loss of activity toward 3-isopropylmalate.
- V235 (= V194) mutation to A: Reduced activity toward 3-isopropylmalate.
- D264 (= D223) binding ; binding ; mutation to N: Loss of activity toward 3-isopropylmalate.
- N265 (= N224) binding
- D288 (= D247) binding ; mutation to N: Loss of activity toward 3-isopropylmalate.
- D292 (= D251) binding ; mutation to N: Reduced activity toward 3-isopropylmalate.
- 318:334 (vs. 277:293, 76% identical) binding
5j33A Isopropylmalate dehydrogenase in complex with NAD+ (see paper)
61% identity, 99% coverage: 5:358/359 of query aligns to 5:359/360 of 5j33A
- active site: Y141 (= Y141), K192 (= K191), D224 (= D223), D248 (= D247), D252 (= D251)
- binding magnesium ion: D248 (= D247), D252 (= D251)
- binding nicotinamide-adenine-dinucleotide: I74 (≠ V73), E89 (= E89), L92 (= L92), I261 (= I260), E278 (= E277), H281 (= H280), G282 (= G281), S283 (= S282), A284 (= A283), I287 (= I286), N294 (= N293), D335 (= D334)
5j32A Isopropylmalate dehydrogenase in complex with isopropylmalate (see paper)
61% identity, 99% coverage: 5:358/359 of query aligns to 15:369/369 of 5j32A
Q9SA14 3-isopropylmalate dehydrogenase 3, chloroplastic; 3-IPM-DH 3; AtIMDH2; AtIMDH3; IMDH 3; Beta-IPM dehydrogenase 3; Isopropylmalate dehydrogenase 3; AtIMD3; EC 1.1.1.85 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
61% identity, 99% coverage: 4:358/359 of query aligns to 45:400/404 of Q9SA14
- L134 (= L93) Confers substrate specificity; mutation to F: Enhanced activity toward 3-(2'-methylthio)-ethylmalate, but reduced catalytic efficiency with 3-isopropylmalate.
Q9FMT1 3-isopropylmalate dehydrogenase 1, chloroplastic; 3-IPM-DH 1; AtIMDH1; IMDH 1; Beta-IPM dehydrogenase 1; Isopropylmalate dehydrogenase 1; AtIMD1; Methylthioalkylmalate dehydrogenase 1; EC 1.1.1.85 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
61% identity, 99% coverage: 4:358/359 of query aligns to 48:403/409 of Q9FMT1
- F137 (≠ L93) Confers substrate specificity; mutation to L: Reduced activity toward 3-(2'-methylthio)-ethylmalate, but enhanced catalytic efficiency with 3-isopropylmalate.
- C232 (= C187) Essential for redox regulation; mutation to S: Reduced sensitivity to oxidation on enzyme activity regulation.
- C390 (≠ T345) Essential for redox regulation; mutation to S: Reduced sensitivity to oxidation on enzyme activity regulation.
1cnzA 3-isopropylmalate dehydrogenase (ipmdh) from salmonella typhimurium (see paper)
55% identity, 97% coverage: 4:352/359 of query aligns to 6:355/363 of 1cnzA
P37412 3-isopropylmalate dehydrogenase; 3-IPM-DH; Beta-IPM dehydrogenase; IMDH; EC 1.1.1.85 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
55% identity, 97% coverage: 4:352/359 of query aligns to 6:355/363 of P37412
- D227 (= D223) binding
- D251 (= D247) binding
- D255 (= D251) binding
6xxyA Crystal structure of haemophilus influenzae 3-isopropylmalate dehydrogenase in complex with o-isobutenyl oxalylhydroxamate. (see paper)
56% identity, 99% coverage: 2:355/359 of query aligns to 3:357/358 of 6xxyA
- active site: Y144 (= Y141), K194 (= K191), D226 (= D223), D250 (= D247)
- binding magnesium ion: D250 (= D247), D254 (= D251)
- binding nicotinamide-adenine-dinucleotide: S74 (≠ A72), V75 (= V73), G76 (= G74), E90 (= E89), L94 (= L92), Y224 (= Y221), N227 (= N224), M230 (= M227), M263 (≠ I260), G264 (= G261), E280 (= E277), G283 (≠ H280), G284 (= G281), S285 (= S282), A286 (= A283), P287 (= P284), D288 (= D285), I289 (= I286), N296 (= N293), D337 (= D334)
- binding 2-(2-methylprop-2-enoxyamino)-2-oxidanylidene-ethanoic acid: E90 (= E89), R108 (= R106), R137 (= R134), K194 (= K191), V197 (= V194), D226 (= D223), D250 (= D247)
3vmkA 3-isopropylmalate dehydrogenase from shewanella benthica db21 mt-2 (see paper)
54% identity, 99% coverage: 2:356/359 of query aligns to 8:366/369 of 3vmkA
3vkzA 3-isopropylmalate dehydrogenase from shewanella oneidensis mr-1 at atmospheric pressure (see paper)
54% identity, 99% coverage: 2:358/359 of query aligns to 2:362/364 of 3vkzA
2ztwA Structure of 3-isopropylmalate dehydrogenase in complex with the inhibitor and NAD+ (see paper)
57% identity, 90% coverage: 4:326/359 of query aligns to 2:319/345 of 2ztwA
- active site: Y139 (= Y141), K185 (= K191), D217 (= D223), D241 (= D247), D245 (= D251)
- binding magnesium ion: G203 (≠ A209), Y206 (= Y212), V209 (= V215)
- binding nicotinamide-adenine-dinucleotide: I11 (= I13), H273 (= H280), G274 (= G281), A276 (= A283), D278 (= D285), I279 (= I286), A285 (= A292), N286 (= N293)
Q5SIY4 3-isopropylmalate dehydrogenase; 3-IPM-DH; Beta-IPM dehydrogenase; IMDH; EC 1.1.1.85 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see 2 papers)
57% identity, 90% coverage: 4:326/359 of query aligns to 2:319/345 of Q5SIY4
- 74:87 (vs. 75:89, 60% identical) binding
- Y139 (= Y141) mutation to F: Large decrease in activity and a small decrease in substrate affinity.
- 274:286 (vs. 281:293, 100% identical) binding
2y41A Structure of isopropylmalate dehydrogenase from thermus thermophilus - complex with ipm and mn (see paper)
57% identity, 90% coverage: 4:326/359 of query aligns to 3:320/346 of 2y41A
2y42D Structure of isopropylmalate dehydrogenase from thermus thermophilus - complex with nadh and mn (see paper)
57% identity, 90% coverage: 4:326/359 of query aligns to 3:320/355 of 2y42D
- active site: Y140 (= Y141), K186 (= K191), D218 (= D223), D242 (= D247), D246 (= D251)
- binding manganese (ii) ion: D242 (= D247), D246 (= D251)
- binding nicotinamide-adenine-dinucleotide: I12 (= I13), D79 (= D79), H274 (= H280), G275 (= G281), A277 (= A283), D279 (= D285), I280 (= I286), N287 (= N293)
P18869 3-isopropylmalate dehydrogenase; 3-IPM-DH; IMDH; Beta-IPM dehydrogenase; EC 1.1.1.85 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
45% identity, 99% coverage: 3:357/359 of query aligns to 4:368/371 of P18869
- T55 (≠ E52) modified: Phosphothreonine
Q72IW9 Isocitrate/homoisocitrate dehydrogenase; Homoisocitrate dehydrogenase; HICDH; EC 1.1.1.286 from Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27) (see 4 papers)
40% identity, 100% coverage: 1:358/359 of query aligns to 1:333/334 of Q72IW9
- E57 (≠ D60) mutation to V: Confers enzyme activity with 3-isopropylmalate; when associated with I-72; M-85; A-86; T-208; Y-217; M-238 and M-310.
- ATS 70:72 (≠ VGG 73:75) binding
- S72 (≠ G75) binding in other chain; mutation to I: Confers enzyme activity with 3-isopropylmalate; when associated with V-57; M-85; A-86; T-208; Y-217; M-238 and M-310.
- R85 (vs. gap) binding in other chain; mutation to M: Confers enzyme activity with 3-isopropylmalate; when associated with V-57; I-72; A-86; T-208; Y-217; M-238 and M-310.; mutation to V: Confers low enzyme activity with 3-isopropylmalate. Reduces activity with homoisocitrate. Abolishes activity with isocitrate.
- Y86 (vs. gap) mutation to A: Confers enzyme activity with 3-isopropylmalate; when associated with V-57; I-72; M-85; T-208; Y-217; M-238 and M-310.
- R88 (= R96) binding in other chain
- R98 (= R106) binding in other chain
- R118 (= R134) binding in other chain
- Y125 (= Y141) binding in other chain; mutation to A: Reduces catalytic efficiency with isocitrate.
- V135 (= V156) mutation to M: Formation of homodimers instead of homotetramers. Increased affinity for isocitrate. Reduces enzyme activity with isocitrate.
- K171 (= K191) binding
- N173 (= N193) binding ; binding
- D204 (= D223) binding
- M208 (= M227) mutation to T: Confers enzyme activity with 3-isopropylmalate; when associated with V-57; I-72; M-85; A-86; T-208; Y-217; M-238 and M-310.
- F217 (= F236) mutation to Y: Confers enzyme activity with 3-isopropylmalate; when associated with V-57; I-72; M-85; A-86; T-208; M-238 and M-310.
- D228 (= D247) binding
- D232 (= D251) binding
- V238 (≠ T257) mutation to M: Confers enzyme activity with 3-isopropylmalate; when associated with V-57; I-72; M-85; A-86; T-208; Y-217; and M-310.
- GSAPD 261:265 (= GSAPD 281:285) binding
- N273 (= N293) binding
- R310 (= R331) mutation to M: Confers enzyme activity with 3-isopropylmalate; when associated with V-57; I-72; M-85; A-86; T-208; Y-217; and M-238.
Query Sequence
>WP_086508767.1 NCBI__GCF_002151265.1:WP_086508767.1
MTRKILVLPGDGIGPEITAEASRILAACQAHGLDIEIEQGLVGGSAYDEHGEPLPAVTLD
KAKAADAILLGAVGGPKWDKLEDLAKRPEKGLLGLRKNLGLFANLRPAITYPQLASASSL
KPELVAGLDIMIVRELTGGIYFGQPRGIEVRDGQRVGFNTYIYSESEIERIGRVAFELAQ
KRGKRLCSVDKANVLEVTILWREVMERLAPEYPDVELSHMYVDNAAMQLVRAPKQFDVMV
TGNMFGDILSDAAAMLTGSIGMLPSASLNESGQGMYEPCHGSAPDIAGKGIANPLATILS
VAMMLRYSLGEPEFAGRIEAAVGKVLDDGLRTADIASEGTRTVSTREMGDAVLAAFEAA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory