SitesBLAST
Comparing WP_086508780.1 NCBI__GCF_002151265.1:WP_086508780.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5ey5B Lbcats
68% identity, 95% coverage: 15:398/404 of query aligns to 1:383/383 of 5ey5B
- binding pyridoxal-5'-phosphate: H81 (= H95), K82 (= K96), Q109 (= Q123), S185 (≠ T199), G227 (= G241), G229 (= G243), S230 (= S244), N231 (= N245), E345 (= E360), S371 (= S386), G372 (= G387)
5t6mB Structure of the tryptophan synthase b-subunit from pyroccus furiosus with b-methyltryptophan non-covalently bound (see paper)
62% identity, 95% coverage: 17:401/404 of query aligns to 3:386/386 of 5t6mB
1v8zA X-ray crystal structure of the tryptophan synthase b2 subunit from hyperthermophile, pyrococcus furiosus (see paper)
62% identity, 95% coverage: 17:401/404 of query aligns to 3:386/386 of 1v8zA
- active site: K82 (= K96), E104 (= E118), S371 (= S386)
- binding pyridoxal-5'-phosphate: H81 (= H95), K82 (= K96), Q109 (= Q123), S185 (≠ T199), G227 (= G241), G228 (= G242), G229 (= G243), S230 (= S244), N231 (= N245), E345 (= E360), S371 (= S386), G372 (= G387)
5dw0A Trpb from pyrococcus furiosus with l-serine bound as the external aldimine (see paper)
62% identity, 95% coverage: 17:401/404 of query aligns to 3:386/388 of 5dw0A
- active site: K82 (= K96), E104 (= E118), S371 (= S386)
- binding [3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridin-4-ylmethyl]-serine: H81 (= H95), K82 (= K96), T105 (= T119), G106 (= G120), A107 (= A121), Q109 (= Q123), H110 (= H124), S185 (≠ T199), G227 (= G241), G229 (= G243), S230 (= S244), N231 (= N245), G298 (= G313), D300 (= D315), E345 (= E360), S371 (= S386)
6am8B Engineered tryptophan synthase b-subunit from pyrococcus furiosus, pftrpb2b9 with trp bound as e(aex2) (see paper)
62% identity, 95% coverage: 17:398/404 of query aligns to 3:383/385 of 6am8B
- active site: K82 (= K96), E104 (= E118), S371 (= S386)
- binding [3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridin-4-ylmethyl]-l-tryptophane: H81 (= H95), K82 (= K96), E104 (= E118), T105 (= T119), G106 (= G120), A107 (= A121), Q109 (= Q123), H110 (= H124), L161 (= L175), S185 (≠ T199), V187 (≠ A201), G227 (= G241), G228 (= G242), G229 (= G243), S230 (= S244), N231 (= N245), G298 (= G313), Y301 (= Y316), E345 (= E360), S371 (= S386), G372 (= G387)
- binding tryptophan: P12 (≠ S26), L169 (= L183), S274 (≠ L289), H275 (= H290)
5ixjD Tryptophan synthase beta-subunit from pyrococcus furiosus with l- threonine non-covalently bound in the active site (see paper)
62% identity, 95% coverage: 17:401/404 of query aligns to 3:384/394 of 5ixjD
5dw3A Tryptophan synthase beta-subunit from pyrococcus furiosus with product l-tryptophan non-covalently bound in the active site (see paper)
62% identity, 95% coverage: 17:399/404 of query aligns to 3:383/383 of 5dw3A
- active site: K82 (= K96), E104 (= E118), S370 (= S386)
- binding tryptophan: K82 (= K96), E104 (= E118), T105 (= T119), G106 (= G120), A107 (= A121), Q109 (= Q123), H110 (= H124), S185 (≠ T199), G228 (= G242), Y300 (= Y316)
7rnpA Engineered tryptophan synthase b-subunit from pyrococcus furiosus, pftrpb2b9_h275e with 4-cl-trp non-covalently bound (see paper)
62% identity, 95% coverage: 17:398/404 of query aligns to 3:383/384 of 7rnpA
5t6mA Structure of the tryptophan synthase b-subunit from pyroccus furiosus with b-methyltryptophan non-covalently bound (see paper)
62% identity, 95% coverage: 17:400/404 of query aligns to 3:383/383 of 5t6mA
5vm5D Engineered tryptophan synthase b-subunit from pyrococcus furiosus, pftrpb2b9, with ser bound (see paper)
62% identity, 95% coverage: 17:398/404 of query aligns to 3:381/383 of 5vm5D
- active site: K82 (= K96), E104 (= E118), S369 (= S386)
- binding 2-{[(E)-{3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene]amino}prop-2-enoic acid: H81 (= H95), K82 (= K96), T105 (= T119), G106 (= G120), A107 (= A121), Q109 (= Q123), H110 (= H124), S185 (≠ T199), G227 (= G241), G229 (= G243), S230 (= S244), N231 (= N245), G296 (= G313), E343 (= E360), S369 (= S386)
6cutA Engineered holo trpb from pyrococcus furiosus, pftrpb7e6 with (2s,3s)- isopropylserine bound as the external aldimine (see paper)
61% identity, 95% coverage: 17:398/404 of query aligns to 3:383/385 of 6cutA
- binding (2S,3S)-3-hydroxy-2-[(E)-({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene)amino]-4-methylpentanoic acid (non-preferred name): H81 (= H95), K82 (= K96), T105 (= T119), G106 (= G120), A107 (= A121), Q109 (= Q123), H110 (= H124), S185 (≠ T199), G227 (= G241), G229 (= G243), S230 (= S244), N231 (= N245), G298 (= G313), E345 (= E360), S371 (= S386)
6cuzA Engineered trpb from pyrococcus furiosus, pftrpb7e6 with (2s,3r)- ethylserine bound as the amino-acrylate (see paper)
61% identity, 95% coverage: 17:398/404 of query aligns to 3:383/383 of 6cuzA
- binding (2E)-2-[(E)-({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene)amino]pent-2-enoic acid: H81 (= H95), K82 (= K96), T105 (= T119), G106 (= G120), A107 (= A121), Q109 (= Q123), H110 (= H124), S185 (≠ T199), G227 (= G241), G229 (= G243), S230 (= S244), N231 (= N245), G298 (= G313), E345 (= E360), S371 (= S386)
5ocwB Structure of mycobacterium tuberculosis tryptophan synthase in space group f222 (see paper)
58% identity, 97% coverage: 11:402/404 of query aligns to 5:398/399 of 5ocwB
- active site: K93 (= K96), E115 (= E118), S382 (= S386)
- binding 2-[({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)amino]acrylic acid: H92 (= H95), K93 (= K96), T116 (= T119), G117 (= G120), A118 (= A121), Q120 (= Q123), H121 (= H124), T196 (= T199), G238 (= G241), G240 (= G243), S241 (= S244), N242 (= N245), G309 (= G313), E356 (= E360), S382 (= S386)
6usaB Crystal structure of tryptophan synthase from m. Tuberculosis - aminoacrylate- and gsk1-bound form (see paper)
58% identity, 97% coverage: 11:402/404 of query aligns to 9:402/404 of 6usaB
- active site: K97 (= K96), E119 (= E118), S386 (= S386)
- binding 2-[({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)amino]acrylic acid: H96 (= H95), K97 (= K96), T120 (= T119), G121 (= G120), A122 (= A121), G123 (= G122), Q124 (= Q123), H125 (= H124), T200 (= T199), G242 (= G241), G244 (= G243), S245 (= S244), N246 (= N245), G313 (= G313), E360 (= E360), S386 (= S386)
- binding (3R,4R)-4-[4-(2-Chlorophenyl)piperazin-1-yl]-1,1-dioxothiolan-3-ol: F184 (≠ L183), W187 (= W186), Y196 (= Y195), F198 (≠ I197), G203 (= G202), P204 (= P203), F207 (≠ Y206), H290 (= H290), G291 (= G291)
6dweB Crystal structure of tryptophan synthase from m. Tuberculosis - aminoacrylate- and brd0059-bound form
58% identity, 97% coverage: 11:402/404 of query aligns to 9:402/404 of 6dweB
- active site: K97 (= K96), E119 (= E118), S386 (= S386)
- binding (2R,3S,4R)-3-(2',6'-difluoro-4'-methyl[1,1'-biphenyl]-4-yl)-4-(fluoromethyl)azetidine-2-carbonitrile: F184 (≠ L183), Y196 (= Y195), F198 (≠ I197), P204 (= P203), F207 (≠ Y206), H290 (= H290)
- binding 2-[({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)amino]acrylic acid: H96 (= H95), K97 (= K96), T120 (= T119), G121 (= G120), A122 (= A121), G123 (= G122), Q124 (= Q123), H125 (= H124), T200 (= T199), G242 (= G241), G244 (= G243), S245 (= S244), N246 (= N245), G313 (= G313), E360 (= E360), S386 (= S386)
6u6cB Crystal structure of tryptophan synthase from m. Tuberculosis - aminoacrylate- and gsk2-bound form (see paper)
58% identity, 97% coverage: 11:402/404 of query aligns to 10:403/405 of 6u6cB
- active site: K98 (= K96), E120 (= E118), S387 (= S386)
- binding 2-[({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)amino]acrylic acid: H97 (= H95), K98 (= K96), T121 (= T119), G122 (= G120), A123 (= A121), Q125 (= Q123), H126 (= H124), T201 (= T199), G243 (= G241), G245 (= G243), S246 (= S244), N247 (= N245), G314 (= G313), E361 (= E360), S387 (= S386)
- binding 1-(2-fluorobenzene-1-carbonyl)-N-methyl-2,3-dihydro-1H-indole-5-sulfonamide: Y26 (≠ F24), F185 (≠ L183), W188 (= W186), Y197 (= Y195), F199 (≠ I197), G204 (= G202), P205 (= P203), H291 (= H290), G292 (= G291)
5tciH Crystal structure of tryptophan synthase from m. Tuberculosis - brd4592-bound form (see paper)
58% identity, 97% coverage: 11:402/404 of query aligns to 10:403/406 of 5tciH
- active site: K98 (= K96), E120 (= E118), S387 (= S386)
- binding (2R,3S,4R)-3-(2'-fluoro[1,1'-biphenyl]-4-yl)-4-(hydroxymethyl)azetidine-2-carbonitrile: P28 (≠ S26), L31 (= L29), Y197 (= Y195), F199 (≠ I197), P205 (= P203), F208 (≠ Y206), H291 (= H290)
6uapB Crystal structure of tryptophan synthase from m. Tuberculosis - open form with brd6309 bound
58% identity, 97% coverage: 11:402/404 of query aligns to 9:402/405 of 6uapB
- active site: K97 (= K96), E119 (= E118), S386 (= S386)
- binding (2R,3S,4R)-3-(4'-chloro-2',6'-difluoro[1,1'-biphenyl]-4-yl)-4-(fluoromethyl)azetidine-2-carbonitrile: I180 (≠ M179), N181 (= N180), F184 (≠ L183), Y196 (= Y195), F198 (≠ I197), P204 (= P203), F207 (≠ Y206), H290 (= H290)
8egzB Engineered tyrosine synthase (tmtyrs1) derived from t. Maritima trpb with ser bound as the amino-acrylate intermediate
58% identity, 95% coverage: 14:396/404 of query aligns to 1:377/386 of 8egzB
- binding 2-{[(E)-{3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene]amino}prop-2-enoic acid: H81 (= H95), K82 (= K96), T105 (= T119), G106 (= G120), A107 (= A121), Q109 (= Q123), H110 (= H124), S185 (≠ T199), G229 (= G243), S230 (= S244), N231 (= N245), G297 (= G313), E344 (= E360), S367 (= S386)
8eh0A Engineered tyrosine synthase (tmtyrs1) derived from t. Maritima trpb with ser bound as the amino-acrylate intermediate and complexed with quinoline n-oxide
58% identity, 95% coverage: 15:396/404 of query aligns to 1:376/385 of 8eh0A
- binding 2-{[(E)-{3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene]amino}prop-2-enoic acid: H80 (= H95), K81 (= K96), T104 (= T119), G105 (= G120), A106 (= A121), Q108 (= Q123), H109 (= H124), S184 (≠ T199), G228 (= G243), S229 (= S244), N230 (= N245), G296 (= G313), E343 (= E360), S366 (= S386), G367 (= G387)
- binding 1-oxo-1lambda~5~-quinoline: L160 (= L175), I164 (≠ M179), Y180 (= Y195), P182 (≠ I197), G183 (= G198), S184 (≠ T199), V186 (≠ A201), Y299 (= Y316)
Query Sequence
>WP_086508780.1 NCBI__GCF_002151265.1:WP_086508780.1
MSKFSDLTRLPDARGHFGPYGGRFVSETLSFALDDLEKTYMRLRDDPDFQAEFDYDLAHY
VGRPSPLYHAERWSKKLGGARIWLKREDLNHTGAHKVNNTIGQALLAKMSGKPRVIAETG
AGQHGVATATVAARLGLKCEVYMGAEDVQRQKLNVYRMRLLGANVIPVESGTRTLKDAMN
EALRDWVTNVDDTFYIIGTVAGPHPYPMLVRDFNAVVGREARRQSLEEFGKLPDALIACV
GGGSNAMGLFYPFVEDDEVAMYGVEAGGDGVETGRHAAPLASNAPRGVLHGNRTYLMSDE
GGQVSDTHSISAGLDYPGVGPEHALWKDVGRVQYVAANDDAVLEAFRELTRIEGIMPALE
SAHALAHAKVLAPTMRPDQNIVVNLSGRGDKDIMTVAKIDGLEF
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory