Comparing WP_086508811.1 NCBI__GCF_002151265.1:WP_086508811.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4yjiA The crystal structure of a bacterial aryl acylamidase belonging to the amidase signature (as) enzymes family (see paper)
31% identity, 96% coverage: 11:458/468 of query aligns to 8:477/490 of 4yjiA
2f2aA Structure of tRNA-dependent amidotransferase gatcab complexed with gln (see paper)
28% identity, 95% coverage: 13:457/468 of query aligns to 10:476/485 of 2f2aA
2dqnA Structure of tRNA-dependent amidotransferase gatcab complexed with asn (see paper)
28% identity, 95% coverage: 13:457/468 of query aligns to 10:476/485 of 2dqnA
3h0mA Structure of tRNA-dependent amidotransferase gatcab from aquifex aeolicus (see paper)
29% identity, 95% coverage: 13:457/468 of query aligns to 9:469/478 of 3h0mA
3h0lA Structure of tRNA-dependent amidotransferase gatcab from aquifex aeolicus (see paper)
29% identity, 95% coverage: 13:457/468 of query aligns to 9:469/478 of 3h0lA
3a1iA Crystal structure of rhodococcus sp. N-771 amidase complexed with benzamide (see paper)
30% identity, 90% coverage: 31:453/468 of query aligns to 25:496/508 of 3a1iA
5h6sC Crystal structure of hydrazidase s179a mutant complexed with a substrate (see paper)
28% identity, 95% coverage: 9:453/468 of query aligns to 5:443/457 of 5h6sC
Q7XJJ7 Fatty acid amide hydrolase; AtFAAH; N-acylethanolamine amidohydrolase; EC 3.5.1.99 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
28% identity, 95% coverage: 18:460/468 of query aligns to 138:594/607 of Q7XJJ7
6diiH Structure of arabidopsis fatty acid amide hydrolase in complex with methyl linolenyl fluorophosphonate (see paper)
28% identity, 95% coverage: 18:460/468 of query aligns to 138:594/616 of 6diiH
Sites not aligning to the query:
3a2qA Structure of 6-aminohexanoate cyclic dimer hydrolase complexed with substrate (see paper)
29% identity, 98% coverage: 10:466/468 of query aligns to 6:479/482 of 3a2qA
3kfuE Crystal structure of the transamidosome (see paper)
29% identity, 95% coverage: 11:456/468 of query aligns to 2:456/468 of 3kfuE
1m21A Crystal structure analysis of the peptide amidase pam in complex with the competitive inhibitor chymostatin (see paper)
29% identity, 95% coverage: 10:453/468 of query aligns to 7:475/487 of 1m21A
6c6gA An unexpected vestigial protein complex reveals the evolutionary origins of an s-triazine catabolic enzyme. Inhibitor bound complex. (see paper)
36% identity, 53% coverage: 18:263/468 of query aligns to 10:257/457 of 6c6gA
4gysB Granulibacter bethesdensis allophanate hydrolase co-crystallized with malonate (see paper)
27% identity, 88% coverage: 32:443/468 of query aligns to 25:427/461 of 4gysB
6te4A Structural insights into pseudomonas aeruginosa type six secretion system exported effector 8: tse8 in complex with a peptide (see paper)
32% identity, 47% coverage: 13:232/468 of query aligns to 9:236/564 of 6te4A
Sites not aligning to the query:
Q936X2 Allophanate hydrolase; EC 3.5.1.54 from Pseudomonas sp. (strain ADP) (see paper)
26% identity, 87% coverage: 48:455/468 of query aligns to 58:462/605 of Q936X2
1o9oA Crystal structure of the s131a mutant of malonamidase e2 complexed with malonamate from bradyrhizobium japonicum (see paper)
29% identity, 61% coverage: 14:300/468 of query aligns to 7:261/412 of 1o9oA
Sites not aligning to the query:
Q9TUI8 Fatty-acid amide hydrolase 1; Anandamide amidase; Anandamide amidohydrolase 1; Fatty acid ester hydrolase; Oleamide hydrolase 1; EC 3.5.1.99; EC 3.1.1.- from Sus scrofa (Pig) (see paper)
29% identity, 62% coverage: 6:293/468 of query aligns to 74:357/579 of Q9TUI8
1ocmA The crystal structure of malonamidase e2 covalently complexed with pyrophosphate from bradyrhizobium japonicum (see paper)
29% identity, 61% coverage: 14:300/468 of query aligns to 7:261/412 of 1ocmA
Sites not aligning to the query:
3ppmA Crystal structure of a noncovalently bound alpha-ketoheterocycle inhibitor (phenhexyl/oxadiazole/pyridine) to a humanized variant of fatty acid amide hydrolase (see paper)
29% identity, 59% coverage: 18:293/468 of query aligns to 54:325/546 of 3ppmA
Sites not aligning to the query:
>WP_086508811.1 NCBI__GCF_002151265.1:WP_086508811.1
MSDTDLGAMDAGQLRALFESGKASPLEATRAALERIERFNEAVNAYVLVDREGAETAAEA
SNKRWQQGRPLSAIDGIPVSLKDLTESVGLPARKGSLTVSDAPCERDSPPARMLREAGAV
ILGKTNTPEFGWKAITDNRVFGATANPWDTRLTPGGSSGGAAVAAALNMGVLHQGGDSGG
SIRIPASFTGVFGFKPTFGWVPEWPRSKEATLSHLGPLTRTVEDAVRMLNVMGRYDYRDP
YALRGQPADWGEELGQGIEGMRIAFSPTLGYARVEPEVAECVRQAAHRLEALGAVVEEVD
PGFESPIRIFNTLWFTASLAVYREHSERQRRLLDSGLVADAKRAERLSALDMFYALRDRA
RLTESLEHFNQRYHLVMTPSVAVRPFPLHHDVPPGSGMRDWEEWAPFSYPFNLSQQPAAS
IPCGFTPDGLPVGFQLAGGKHDDARVLRVSQAYLEAYPPTFPERPNQV
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory