Comparing WP_086508843.1 NCBI__GCF_002151265.1:WP_086508843.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7bcrA Crystal structure of the sugar acid binding protein dctpam from advenella mimigardefordensis strain dpn7t in complex with galactonate (see paper)
32% identity, 89% coverage: 32:327/333 of query aligns to 8:304/310 of 7bcrA
7bcpA Crystal structure of the sugar acid binding protein dctpam from advenella mimigardefordensis strain dpn7t in complex with gluconate (see paper)
32% identity, 89% coverage: 32:327/333 of query aligns to 8:304/310 of 7bcpA
7bcoA Crystal structure of the sugar acid binding protein dctpam from advenella mimigardefordensis strain dpn7t in complex with d-foconate (see paper)
32% identity, 89% coverage: 32:327/333 of query aligns to 8:304/310 of 7bcoA
7bcnA Crystal structure of the sugar acid binding protein dctpam from advenella mimigardefordensis strain dpn7t in complex with xylonic acid (see paper)
32% identity, 89% coverage: 32:327/333 of query aligns to 8:304/310 of 7bcnA
7bbrA Crystal structure of the sugar acid binding protein dctpam from advenella mimigardefordensis strain dpn7t (see paper)
32% identity, 89% coverage: 32:327/333 of query aligns to 9:305/310 of 7bbrA
4pdhA Crystal structure of a trap periplasmic solute binding protein from polaromonas sp js666 (bpro_1871, target efi-510164) bound to d- erythronate (see paper)
34% identity, 86% coverage: 28:315/333 of query aligns to 1:287/301 of 4pdhA
4p9kA Crystal structure of a trap periplasmic solute binding protein from verminephrobacter eiseniae ef01-2 (veis_3954, target efi-510324) a nephridial symbiont of the earthworm eisenia foetida, bound to d- erythronate with residual density suggestive of superposition with copurified alternative ligand. (see paper)
33% identity, 90% coverage: 26:325/333 of query aligns to 1:299/303 of 4p9kA
4pakA Crystal structure of a trap periplasmic solute binding protein from verminephrobacter eiseniae ef01-2 (veis_3954, target efi-510324) a nephridial symbiont of the earthworm eisenia foetida, bound to (r)- pantoic acid (see paper)
33% identity, 90% coverage: 26:325/333 of query aligns to 2:300/304 of 4pakA
A3QCW5 C4-dicarboxylate-binding periplasmic protein DctP from Shewanella loihica (strain ATCC BAA-1088 / PV-4) (see paper)
30% identity, 96% coverage: 4:322/333 of query aligns to 12:328/336 of A3QCW5
4pddA Crystal structure of a trap periplasmic solute binding protein from polaromonas sp js666 (bpro_0088, target efi-510167) bound to d- erythronate (see paper)
36% identity, 72% coverage: 39:278/333 of query aligns to 12:251/303 of 4pddA
Sites not aligning to the query:
4oanA Crystal structure of a trap periplasmic solute binding protein from rhodopseudomonas palustris haa2 (rpb_2686), target efi-510221, with density modeled as (s)-2-hydroxy-2-methyl-3-oxobutanoate ((s)-2- acetolactate) (see paper)
31% identity, 81% coverage: 27:295/333 of query aligns to 5:270/312 of 4oanA
4xeqB Crystal structure of a trap periplasmic solute binding protein from desulfovibrio vulgaris (deval_0042, target efi-510114) bound to copurified (r)-pantoic acid
35% identity, 72% coverage: 46:286/333 of query aligns to 19:258/304 of 4xeqB
Sites not aligning to the query:
4nq8B Crystal structure of a trap periplasmic solute binding protein from bordetella bronchispeptica (bb3421), target efi-510039, with density modeled as pantoate (see paper)
30% identity, 90% coverage: 28:327/333 of query aligns to 1:298/301 of 4nq8B
4pf8A Crystal structure of a trap periplasmic solute binding protein from sulfitobacter sp. Nas-14.1 (target efi-510299) with bound beta-d- galacturonate (see paper)
29% identity, 85% coverage: 31:313/333 of query aligns to 2:283/300 of 4pf8A
P44542 Sialic acid-binding periplasmic protein SiaP; Extracytoplasmic solute receptor protein SiaP; N-acetylneuraminic-binding protein; Neu5Ac-binding protein from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) (see 2 papers)
31% identity, 93% coverage: 4:313/333 of query aligns to 3:309/329 of P44542
4p3lA Crystal structure of a trap periplasmic solute binding protein from chromohalobacter salexigens dsm 3043 (csal_2479), target efi-510085, with bound glucuronate, spg p6122 (see paper)
30% identity, 87% coverage: 30:318/333 of query aligns to 2:296/303 of 4p3lA
4x8rA Crystal structure of a trap periplasmic solute binding protein from rhodobacter sphaeroides (rsph17029_2138, target efi-510205) with bound glucuronate
29% identity, 86% coverage: 27:313/333 of query aligns to 2:287/304 of 4x8rA
Q16BC9 Solute-binding protein RD1_1052 from Roseobacter denitrificans (strain ATCC 33942 / OCh 114) (Erythrobacter sp. (strain OCh 114)) (Roseobacter denitrificans) (see paper)
31% identity, 75% coverage: 28:277/333 of query aligns to 28:276/325 of Q16BC9
4pcdA Crystal structure of a trap periplasmic solute binding protein from roseobacter denitrificans och 114 (rd1_1052, target efi-510238) with bound l-galactonate (see paper)
31% identity, 75% coverage: 28:277/333 of query aligns to 4:252/300 of 4pcdA
4pc9A Crystal structure of a trap periplasmic solute binding protein from rosenbacter denitrificans och 114 (rd1_1052, target efi-510238) with bound d-mannonate (see paper)
31% identity, 75% coverage: 28:277/333 of query aligns to 4:252/300 of 4pc9A
>WP_086508843.1 NCBI__GCF_002151265.1:WP_086508843.1
MKNKLSKATLVAAIAAASLGMGQAQAAEYTFRFAHVLIEDTPNGQAALRFKQEVEENSDG
RIRIDVLPAAQVGGDVEIIEQIQMGLIDIGIPPTATLGNFEPRLQILDLPFLISDYDTMV
KVLDGDVGREILDTLEAHNMYGVNFWGAGFRHMSNNERPIEGPDDLERIRMRTMQAPIII
STYQNFGANATAMAFTEVYNGLQQGVVSGQENPLANIYTMRFHEVQDYLTLTNHAYHGYA
AVMNSDSWNSLPEDLQEVMREAFDNGRDMARELTLQDEERILEAIQDEIAINELSPEARE
AFIEASMPVHREYESVVTTELLHKVYDEVGISY
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory