Comparing WP_086508853.1 NCBI__GCF_002151265.1:WP_086508853.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 12 hits to proteins with known functional sites (download)
P54955 N-acetylcysteine deacetylase; S-(2-succino)cysteine metabolism operon protein P; EC 3.5.1.- from Bacillus subtilis (strain 168)
38% identity, 94% coverage: 10:379/392 of query aligns to 6:371/380 of P54955
O04373 IAA-amino acid hydrolase ILR1-like 4; jasmonoyl-L-amino acid hydrolase; EC 3.5.1.-; EC 3.5.1.127 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
37% identity, 97% coverage: 3:384/392 of query aligns to 37:423/440 of O04373
P54968 IAA-amino acid hydrolase ILR1; EC 3.5.1.- from Arabidopsis thaliana (Mouse-ear cress) (see paper)
36% identity, 95% coverage: 5:377/392 of query aligns to 43:420/442 of P54968
4ewtA The crystal structure of a putative aminohydrolase from methicillin resistant staphylococcus aureus (see paper)
34% identity, 96% coverage: 4:380/392 of query aligns to 6:384/389 of 4ewtA
6slfA Nalpha-acylglutamine aminoacylase from corynebacterium sp.Releasing human axilla odorants co-crystallised with high affinity inhibitor (see paper)
36% identity, 85% coverage: 13:346/392 of query aligns to 18:348/398 of 6slfA
Sites not aligning to the query:
3ramA Crystal structure of hmra (see paper)
27% identity, 92% coverage: 16:377/392 of query aligns to 20:366/391 of 3ramA
1cg2A Carboxypeptidase g2 (see paper)
27% identity, 54% coverage: 54:264/392 of query aligns to 65:268/389 of 1cg2A
Sites not aligning to the query:
P06621 Carboxypeptidase G2; CPDG2; Folate hydrolase G2; Glutamate carboxypeptidase; Pteroylmonoglutamic acid hydrolase G2; Glucarpidase; EC 3.4.17.11 from Pseudomonas sp. (strain RS-16) (see paper)
27% identity, 54% coverage: 54:264/392 of query aligns to 90:293/415 of P06621
Sites not aligning to the query:
P44514 Succinyl-diaminopimelate desuccinylase; SDAP desuccinylase; N-succinyl-LL-2,6-diaminoheptanedioate amidohydrolase; EC 3.5.1.18 from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) (see 3 papers)
24% identity, 53% coverage: 110:318/392 of query aligns to 108:314/377 of P44514
Sites not aligning to the query:
7m6uB Crystal structure of a circular permutation and computationally designed pro-enzyme of carboxypeptidase g2 (see paper)
27% identity, 53% coverage: 56:264/392 of query aligns to 2:203/392 of 7m6uB
Sites not aligning to the query:
5vo3A Crystal structure of dape in complex with the products (succinic acid and diaminopimelic acid) (see paper)
24% identity, 53% coverage: 110:318/392 of query aligns to 112:318/380 of 5vo3A
Sites not aligning to the query:
7t1qA Crystal structure of the succinyl-diaminopimelate desuccinylase (dape) from acinetobacter baumannii in complex with succinic acid
21% identity, 48% coverage: 97:286/392 of query aligns to 91:285/377 of 7t1qA
Sites not aligning to the query:
>WP_086508853.1 NCBI__GCF_002151265.1:WP_086508853.1
MPTIARIAEYQDELAEIRHDIHAHPELGFEETRTAALVAEKLRAWDIDEVHTDIAGTGVV
GVIKGREEGRCIGLRADMDALPIQEATDLPYASRHAGKMHACGHDGHTTILLGAARYLAE
TRDFAGTVVLIFQPAEEGLGGARRMLADRLFERFPCDEIYGIHNDPTSDPGKVSVTPGPA
MAGATFFDIVIEGKGAHAAMPHQSNDPVIVAAELIHQLQTVVSRNTSPTSPLVLSVTQVH
AGSAYNVIPNEATLAGTIRYFDDEVCERTHERIRLLCKGLELAHEVKIRVDLRNIFNVLV
NEPGCAGAYVAAAAEVVGEENAALVDRLVTGSEDFADMLQVVPGAYCWVGHAGSVPLHNP
GYVLDDGILPVGASIMAKVVERRLPIRQGASA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory