Comparing WP_086508878.1 NCBI__GCF_002151265.1:WP_086508878.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 16 hits to proteins with known functional sites (download)
P22106 Asparagine synthetase B [glutamine-hydrolyzing]; AS-B; EC 6.3.5.4 from Escherichia coli (strain K12) (see 2 papers)
32% identity, 60% coverage: 1:378/631 of query aligns to 1:358/554 of P22106
1ct9A Crystal structure of asparagine synthetase b from escherichia coli (see paper)
32% identity, 57% coverage: 22:378/631 of query aligns to 23:341/497 of 1ct9A
Sites not aligning to the query:
P78753 Probable asparagine synthetase [glutamine-hydrolyzing]; Glutamine-dependent asparagine synthetase; EC 6.3.5.4 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
31% identity, 60% coverage: 22:400/631 of query aligns to 24:377/557 of P78753
Sites not aligning to the query:
6gq3A Human asparagine synthetase (asns) in complex with 6-diazo-5-oxo-l- norleucine (don) at 1.85 a resolution (see paper)
30% identity, 61% coverage: 2:389/631 of query aligns to 1:369/509 of 6gq3A
P08243 Asparagine synthetase [glutamine-hydrolyzing]; Cell cycle control protein TS11; Glutamine-dependent asparagine synthetase; EC 6.3.5.4 from Homo sapiens (Human) (see 7 papers)
29% identity, 62% coverage: 1:389/631 of query aligns to 1:382/561 of P08243
Sites not aligning to the query:
1jgtB Crystal structure of beta-lactam synthetase (see paper)
27% identity, 42% coverage: 72:333/631 of query aligns to 69:307/500 of 1jgtB
Sites not aligning to the query:
Q9XB61 Carbapenam-3-carboxylate synthase; Carbapenam-3-carboxylate ligase; EC 6.3.3.6 from Pectobacterium carotovorum subsp. carotovorum (Erwinia carotovora subsp. carotovora) (see 3 papers)
26% identity, 44% coverage: 99:377/631 of query aligns to 79:353/503 of Q9XB61
Sites not aligning to the query:
1q19A Carbapenam synthetase (see paper)
26% identity, 44% coverage: 99:377/631 of query aligns to 78:352/500 of 1q19A
Sites not aligning to the query:
Q9STG9 Amidophosphoribosyltransferase 2, chloroplastic; AtATase2; AtPURF2; PRPP2; Glutamine phosphoribosylpyrophosphate amidotransferase 2; AtGPRAT2; Protein CHLOROPLAST IMPORT APPARATUS 1; Protein DIFFERENTIAL DEVELOPMENT OF VASCULAR ASSOCIATED CELLS; EC 2.4.2.14 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
31% identity, 15% coverage: 71:162/631 of query aligns to 183:281/561 of Q9STG9
Sites not aligning to the query:
6lbpA Structure of the glutamine phosphoribosylpyrophosphate amidotransferase from arabidopsis thaliana (see paper)
31% identity, 15% coverage: 71:162/631 of query aligns to 97:195/460 of 6lbpA
Sites not aligning to the query:
P14742 Glutamine--fructose-6-phosphate aminotransferase [isomerizing]; GFAT; D-fructose-6-phosphate amidotransferase; Hexosephosphate aminotransferase; EC 2.6.1.16 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
27% identity, 14% coverage: 19:109/631 of query aligns to 59:148/717 of P14742
Sites not aligning to the query:
2j6hA E. Coli glucosamine-6-p synthase in complex with glucose-6p and 5-oxo- l-norleucine (see paper)
26% identity, 26% coverage: 2:162/631 of query aligns to 1:192/608 of 2j6hA
Sites not aligning to the query:
4amvA E.Coli glucosamine-6p synthase in complex with fructose-6p (see paper)
26% identity, 26% coverage: 2:162/631 of query aligns to 1:192/608 of 4amvA
Sites not aligning to the query:
1jxaA Glucosamine 6-phosphate synthase with glucose 6-phosphate (see paper)
26% identity, 26% coverage: 2:162/631 of query aligns to 1:192/608 of 1jxaA
Sites not aligning to the query:
1xfgA Glutaminase domain of glucosamine 6-phosphate synthase complexed with l-glu hydroxamate (see paper)
26% identity, 26% coverage: 2:162/631 of query aligns to 1:192/238 of 1xfgA
1xffA Glutaminase domain of glucosamine 6-phosphate synthase complexed with glutamate (see paper)
26% identity, 26% coverage: 2:162/631 of query aligns to 1:192/238 of 1xffA
>WP_086508878.1 NCBI__GCF_002151265.1:WP_086508878.1
MCGISGFIDWKNISGLDCIKAMTDVLHHRGPDDSGLFYKQYEGAHVGLGHRRLSILDLSS
HGHQPMDHRHLTIVYNGEVYNFKEIRTELERQGYVFDSGSDTEVILKAYHCWGIEMVHRL
NGMFALAIFDAEKKELVLLRDRAGVKPLYWYYHDGLFLFASELKSFHQHPAFKKELCLDG
LALFLQYGYIPQPHSIFKHTQKLKAGNSLTINLDQRSFEEKKYWDVLDFYRKPKLKVSEE
EALRETERLLTSACEYRMVADVPVGVFLSGGYDSSAVTALLQSHRSEKLKTFAIGFHEEA
YNEAHHARRVAEHLGTDHTEYYCTHQDALDILPRLPEIWDEPFGDASTIPTVLVSELARK
QVTVSLSADGGDEIFGGYDKYIYAKKMESIFGRVPFRNQFGRFLSSIKPGSIPFLSRDPI
FSRRYAKVASSLEAKHSTEMLGIIGSAFFRAEVEELIAKPIVHLATDFESYEGLDEFNDL
YNSLMAVDYKTYQLDDILVKVDRATMSCSLEGREPLLDYRIIEYVARLESSLKIRGDERK
YLLKKITHQYLPKEMMDRPKMGFGVPILDWFRAELRDYLLSYLSESRLAEAGIFNVNKVI
EVRDEYLNGKNDDISKIWFLLVFEMWREKWM
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory