Comparing WP_086508937.1 NCBI__GCF_002151265.1:WP_086508937.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5yhtA Crystal structure of a phosphatase from mycobacterium tuberculosis in complex with its substrate (see paper)
29% identity, 77% coverage: 23:226/266 of query aligns to 25:225/255 of 5yhtA
P95189 Histidinol-phosphatase; HolPase; Histidinol-phosphate phosphatase; EC 3.1.3.15 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
29% identity, 77% coverage: 23:226/266 of query aligns to 28:228/260 of P95189
5zonA Histidinol phosphate phosphatase from mycobacterium tuberculosis (see paper)
29% identity, 77% coverage: 23:226/266 of query aligns to 26:226/256 of 5zonA
Q6NPM8 Bifunctional phosphatase IMPL2, chloroplastic; Histidinol-phosphatase; Histidinol-phosphate phosphatase; HPP; Inositol-phosphate phosphatase; L-galactose 1-phosphate phosphatase; Protein HISTIDINE BIOSYNTHESIS 7; Protein MYO-INOSITOL MONOPHOSPHATASE-LIKE 2; EC 3.1.3.15; EC 3.1.3.25; EC 3.1.3.93 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
26% identity, 82% coverage: 11:228/266 of query aligns to 96:306/346 of Q6NPM8
2p3nA Thermotoga maritima impase tm1415 (see paper)
29% identity, 73% coverage: 32:226/266 of query aligns to 35:216/256 of 2p3nA
O33832 Fructose-1,6-bisphosphatase/inositol-1-monophosphatase; FBPase/IMPase; Inositol-1-phosphatase; I-1-Pase; EC 3.1.3.11; EC 3.1.3.25 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) (see paper)
29% identity, 73% coverage: 32:226/266 of query aligns to 35:216/256 of O33832
Q9M8S8 Inositol-phosphate phosphatase; L-galactose 1-phosphate phosphatase; Myo-inositol monophosphatase; EC 3.1.3.25; EC 3.1.3.93 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
25% identity, 76% coverage: 26:228/266 of query aligns to 35:238/271 of Q9M8S8
Q9K4B1 Histidinol-phosphatase; HolPase; Histidinol-phosphate phosphatase; EC 3.1.3.15 from Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) (see paper)
32% identity, 76% coverage: 23:224/266 of query aligns to 30:231/266 of Q9K4B1
4as5A Structure of mouse inositol monophosphatase 1 (see paper)
26% identity, 82% coverage: 12:229/266 of query aligns to 17:236/274 of 4as5A
P32179 3'(2'),5'-bisphosphate nucleotidase; 3'(2'),5-bisphosphonucleoside 3'(2')-phosphohydrolase; 3'-phosphoadenosine-5'-phosphate phosphatase; 3'-phosphoadenosine-5'-phosphatase; PAP phosphatase; PAPase; DPNPase; Halotolerance protein HAL2; Methionine-requiring protein 22; EC 3.1.3.7 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see 2 papers)
25% identity, 82% coverage: 19:235/266 of query aligns to 29:318/357 of P32179
1qgxA X-ray structure of yeast hal2p (see paper)
25% identity, 82% coverage: 19:235/266 of query aligns to 28:317/354 of 1qgxA
1ka1A The papase hal2p complexed with calcium and magnesium ions and reaction substrate: pap (see paper)
25% identity, 82% coverage: 19:235/266 of query aligns to 28:317/354 of 1ka1A
1k9zA The papase hal2p complexed with zinc ions
25% identity, 82% coverage: 19:235/266 of query aligns to 28:317/354 of 1k9zA
Sites not aligning to the query:
1k9yA The papase hal2p complexed with magnesium ions and reaction products: amp and inorganic phosphate (see paper)
25% identity, 82% coverage: 19:235/266 of query aligns to 28:317/354 of 1k9yA
2bjiA High resolution structure of myo-inositol monophosphatase, the target of lithium therapy (see paper)
26% identity, 82% coverage: 12:228/266 of query aligns to 17:235/274 of 2bjiA
P20456 Inositol monophosphatase 1; IMP 1; IMPase 1; D-galactose 1-phosphate phosphatase; Inositol-1(or 4)-monophosphatase 1; Lithium-sensitive myo-inositol monophosphatase A1; EC 3.1.3.25; EC 3.1.3.94 from Bos taurus (Bovine) (see paper)
26% identity, 82% coverage: 12:228/266 of query aligns to 19:237/277 of P20456
6tqoT Rrn anti-termination complex (see paper)
27% identity, 76% coverage: 25:226/266 of query aligns to 22:219/255 of 6tqoT
O55023 Inositol monophosphatase 1; IMP 1; IMPase 1; D-galactose 1-phosphate phosphatase; Inositol-1(or 4)-monophosphatase 1; Lithium-sensitive myo-inositol monophosphatase A1; EC 3.1.3.25; EC 3.1.3.94 from Mus musculus (Mouse) (see paper)
29% identity, 57% coverage: 79:229/266 of query aligns to 87:238/277 of O55023
Sites not aligning to the query:
2qflA Structure of suhb: inositol monophosphatase and extragenic suppressor from e. Coli (see paper)
27% identity, 83% coverage: 6:226/266 of query aligns to 9:227/262 of 2qflA
P0ADG4 Nus factor SuhB; Inositol-1-monophosphatase; I-1-Pase; IMPase; Inositol-1-phosphatase; EC 3.1.3.25 from Escherichia coli (strain K12) (see 5 papers)
26% identity, 83% coverage: 6:226/266 of query aligns to 9:227/267 of P0ADG4
Sites not aligning to the query:
>WP_086508937.1 NCBI__GCF_002151265.1:WP_086508937.1
MRTRLVEGVHAAGREVLSIYERDFSVETKDDRSPLTEADMASHHALVELLESLTPEVPIL
SEESAEIPFSKRAAWQRYWLIDPLDGTKEFIKKNGEFTLNVALIEAGEPVFGIVHAPVLE
ATWVGQQGQGAWKQENDGALQPIQVRHLPDPKQEAWQVVGSRSHGSKEFEAFRAGLPAHE
CVSMGSSLKLCLVAEGKADLYPRLAPTSEWDTAAAQAVVTAAGGQVLNAHTLEPLRCNQQ
ESVLNPFFIVCGQRDERWESALKASL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory