SitesBLAST
Comparing WP_086509029.1 NCBI__GCF_002151265.1:WP_086509029.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2j6hA E. Coli glucosamine-6-p synthase in complex with glucose-6p and 5-oxo- l-norleucine (see paper)
61% identity, 100% coverage: 2:611/611 of query aligns to 1:608/608 of 2j6hA
- active site: C1 (= C2), R26 (= R27), G27 (= G28), W74 (= W75), N98 (= N100), G99 (= G101), Y248 (= Y251), E481 (= E484), K485 (= K488), E488 (= E491), H504 (= H507), K603 (= K606)
- binding glucose-6-phosphate: T302 (= T305), S347 (= S350), Q348 (= Q351), S349 (= S352), T352 (= T355), V399 (= V402), S401 (= S404), E488 (= E491)
- binding 5-oxo-l-norleucine: C1 (= C2), R73 (= R74), W74 (= W75), T76 (= T77), H86 (= H87), N98 (= N100), G99 (= G101), D123 (= D125)
4amvA E.Coli glucosamine-6p synthase in complex with fructose-6p (see paper)
60% identity, 100% coverage: 2:611/611 of query aligns to 1:608/608 of 4amvA
- active site: C1 (= C2), R26 (= R27), G27 (= G28), W74 (= W75), N98 (= N100), G99 (= G101), Y248 (= Y251), E481 (= E484), K485 (= K488), E488 (= E491), H504 (= H507), K603 (= K606)
- binding fructose -6-phosphate: G301 (= G304), T302 (= T305), S303 (= S306), S347 (= S350), Q348 (= Q351), S349 (= S352), T352 (= T355), S401 (= S404), K485 (= K488), E488 (= E491)
1jxaA Glucosamine 6-phosphate synthase with glucose 6-phosphate (see paper)
60% identity, 100% coverage: 2:611/611 of query aligns to 1:608/608 of 1jxaA
- active site: C1 (= C2), R26 (= R27), G27 (= G28), W74 (= W75), N98 (= N100), G99 (= G101), Y248 (= Y251), E481 (= E484), K485 (= K488), E488 (= E491), H504 (= H507), K603 (= K606)
- binding glucose-6-phosphate: T302 (= T305), S303 (= S306), S347 (= S350), Q348 (= Q351), S349 (= S352), T352 (= T355), S401 (= S404), K485 (= K488), E488 (= E491)
1mosA Isomerase domain of glucosamine 6-phosphate synthase complexed with 2- amino-2-deoxyglucitol 6-phosphate (see paper)
65% identity, 60% coverage: 245:611/611 of query aligns to 1:367/367 of 1mosA
- active site: E240 (= E484), K244 (= K488), E247 (= E491), H263 (= H507), K362 (= K606)
- binding 2-deoxy-2-amino glucitol-6-phosphate: T61 (= T305), S62 (= S306), S106 (= S350), Q107 (= Q351), S108 (= S352), T111 (= T355), K244 (= K488), E247 (= E491)
1morA Isomerase domain of glucosamine 6-phosphate synthase complexed with glucose 6-phosphate (see paper)
66% identity, 60% coverage: 248:611/611 of query aligns to 3:366/366 of 1morA
- active site: E239 (= E484), K243 (= K488), E246 (= E491), H262 (= H507), K361 (= K606)
- binding 6-O-phosphono-alpha-D-glucopyranose: T60 (= T305), S105 (= S350), Q106 (= Q351), S107 (= S352), T110 (= T355), V157 (= V402), A360 (= A605), K361 (= K606)
1moqA Isomerase domain of glucosamine 6-phosphate synthase complexed with glucosamine 6-phosphate (see paper)
66% identity, 60% coverage: 248:611/611 of query aligns to 3:366/366 of 1moqA
- active site: E239 (= E484), K243 (= K488), E246 (= E491), H262 (= H507), K361 (= K606)
- binding 2-amino-2-deoxy-6-O-phosphono-alpha-D-glucopyranose: T60 (= T305), S61 (= S306), S105 (= S350), Q106 (= Q351), S107 (= S352), T110 (= T355), V157 (= V402), A360 (= A605), K361 (= K606)
7dnrA Crystal structure of zn-bound sis domain of glucosamine-6-p synthase from e. Coli
65% identity, 58% coverage: 248:602/611 of query aligns to 3:357/357 of 7dnrA
6r4eA Crystal structure of human gfat-1 in complex with glucose-6-phosphate and l-glu (see paper)
40% identity, 100% coverage: 2:611/611 of query aligns to 1:663/663 of 6r4eA
- active site: L7 (≠ V8), R32 (= R27), W95 (= W75), N122 (= N100), G123 (= G101), E536 (= E484), K540 (= K488), E543 (= E491), H559 (= H507), K658 (= K606)
- binding glucose-6-phosphate: T358 (= T305), S359 (= S306), S403 (= S350), Q404 (= Q351), S405 (= S352), T408 (= T355), S456 (= S404), K540 (= K488), E543 (= E491)
- binding glutamic acid: C1 (= C2), R94 (= R74), W95 (= W75), T97 (= T77), G123 (= G101), D147 (= D125)
6svmA Crystal structure of human gfat-1 in complex with glucose-6-phosphate, l-glu, and udp-galnac (see paper)
40% identity, 100% coverage: 2:611/611 of query aligns to 1:660/660 of 6svmA
- active site: L7 (≠ V8), R32 (= R27), W95 (= W75), N122 (= N100), G123 (= G101), E533 (= E484), K537 (= K488), E540 (= E491), H556 (= H507), K655 (= K606)
- binding glucose-6-phosphate: C353 (= C303), T355 (= T305), S356 (= S306), S400 (= S350), Q401 (= Q351), S402 (= S352), T405 (= T355), S453 (= S404), K537 (= K488), E540 (= E491)
- binding glutamic acid: C1 (= C2), R94 (= R74), W95 (= W75), T97 (= T77), H107 (= H87), G123 (= G101), D147 (= D125)
- binding magnesium ion: S434 (≠ V385), R435 (= R386), T437 (≠ S388)
- binding uridine-diphosphate-n-acetylgalactosamine: Q289 (≠ E240), R322 (= R273), G334 (= G285), G424 (≠ A375), T426 (≠ C377), S434 (≠ V385), T437 (≠ S388), C439 (≠ L390), G440 (≠ T391), V441 (≠ L392), H442 (≠ M393)
6r4gA Crystal structure of human gfat-1 in complex with udp-glcnac (see paper)
39% identity, 99% coverage: 2:604/611 of query aligns to 1:652/652 of 6r4gA
- active site: L7 (≠ V8), R32 (= R27), W95 (= W75), N122 (= N100), G123 (= G101), E532 (= E484), K536 (= K488), E539 (= E491), H555 (= H507)
- binding glucose-6-phosphate: G353 (= G304), T354 (= T305), S355 (= S306), S399 (= S350), Q400 (= Q351), S401 (= S352), T404 (= T355), S452 (= S404), E539 (= E491)
- binding magnesium ion: S433 (≠ V385), R434 (= R386), T436 (≠ S388)
- binding uridine-diphosphate-n-acetylglucosamine: Q288 (≠ E240), R321 (= R273), G333 (= G285), G423 (≠ A375), T425 (≠ C377), S433 (≠ V385), T436 (≠ S388), C438 (≠ L390), G439 (≠ T391), V440 (≠ L392), H441 (≠ M393)
Q06210 Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 1; D-fructose-6-phosphate amidotransferase 1; Glutamine:fructose-6-phosphate amidotransferase 1; GFAT 1; GFAT1; Hexosephosphate aminotransferase 1; EC 2.6.1.16 from Homo sapiens (Human) (see paper)
43% identity, 69% coverage: 188:611/611 of query aligns to 274:699/699 of Q06210
2zj4A Isomerase domain of human glucose:fructose-6-phosphate amidotransferase (see paper)
45% identity, 60% coverage: 248:611/611 of query aligns to 2:365/365 of 2zj4A
- active site: E238 (= E484), K242 (= K488), E245 (= E491), H261 (= H507), K360 (= K606)
- binding 2-deoxy-2-amino glucitol-6-phosphate: T60 (= T305), S61 (= S306), S105 (= S350), Q106 (= Q351), S107 (= S352), T110 (= T355), V156 (= V402), A157 (= A403), K242 (= K488), E245 (= E491)
2zj3A Isomerase domain of human glucose:fructose-6-phosphate amidotransferase (see paper)
45% identity, 60% coverage: 248:611/611 of query aligns to 2:365/365 of 2zj3A
- active site: E238 (= E484), K242 (= K488), E245 (= E491), H261 (= H507), K360 (= K606)
- binding 6-O-phosphono-alpha-D-glucopyranose: T60 (= T305), S61 (= S306), S105 (= S350), Q106 (= Q351), S107 (= S352), T110 (= T355), V156 (= V402), A359 (= A605), K360 (= K606)
P14742 Glutamine--fructose-6-phosphate aminotransferase [isomerizing]; GFAT; D-fructose-6-phosphate amidotransferase; Hexosephosphate aminotransferase; EC 2.6.1.16 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
40% identity, 72% coverage: 174:611/611 of query aligns to 278:717/717 of P14742
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 2 active site, For GATase activity
2v4mA The isomerase domain of human glutamine-fructose-6-phosphate transaminase 1 (gfpt1) in complex with fructose 6-phosphate
44% identity, 58% coverage: 248:599/611 of query aligns to 1:352/352 of 2v4mA
- active site: E237 (= E484), K241 (= K488), E244 (= E491), H260 (= H507)
- binding fructose -6-phosphate: T59 (= T305), S60 (= S306), S104 (= S350), Q105 (= Q351), S106 (= S352), T109 (= T355), A156 (= A403), S157 (= S404), K241 (= K488), E244 (= E491)
2pocB The crystal structure of isomerase domain of glucosamine-6-phosphate synthase from candida albicans (see paper)
43% identity, 57% coverage: 251:599/611 of query aligns to 2:352/352 of 2pocB
- active site: E236 (= E484), K240 (= K488), E243 (= E491), H259 (= H507)
- binding 6-O-phosphono-beta-D-glucopyranose: C55 (= C303), T57 (= T305), S58 (= S306), S102 (= S350), Q103 (= Q351), S104 (= S352), T107 (= T355), E243 (= E491)
- binding uridine-diphosphate-n-acetylglucosamine: R24 (= R273), G36 (= G285), G126 (≠ A375), V128 (≠ C377), S136 (≠ V385), T139 (≠ S388), C141 (≠ L390), G142 (≠ T391), V143 (≠ L392), H144 (≠ M393)
1xfgA Glutaminase domain of glucosamine 6-phosphate synthase complexed with l-glu hydroxamate (see paper)
56% identity, 38% coverage: 2:235/611 of query aligns to 1:232/238 of 1xfgA
- active site: C1 (= C2), R26 (= R27), G27 (= G28), W74 (= W75), N98 (= N100), G99 (= G101)
- binding glutamine hydroxamate: C1 (= C2), R73 (= R74), W74 (= W75), T76 (= T77), H86 (= H87), N98 (= N100), G99 (= G101), D123 (= D125)
1xffA Glutaminase domain of glucosamine 6-phosphate synthase complexed with glutamate (see paper)
56% identity, 38% coverage: 2:235/611 of query aligns to 1:232/238 of 1xffA
- active site: C1 (= C2), R26 (= R27), G27 (= G28), W74 (= W75), N98 (= N100), G99 (= G101)
- binding glutamic acid: C1 (= C2), R73 (= R74), W74 (= W75), T76 (= T77), H86 (= H87), N98 (= N100), G99 (= G101), D123 (= D125)
2putA The crystal structure of isomerase domain of glucosamine-6-phosphate synthase from candida albicans (see paper)
40% identity, 57% coverage: 251:599/611 of query aligns to 2:339/339 of 2putA
- active site: E236 (= E484), K240 (= K488), E243 (= E491)
- binding fructose -6-phosphate: C55 (= C303), T57 (= T305), S102 (= S350), Q103 (= Q351), S104 (= S352), T107 (= T355), A154 (= A403), S155 (= S404), K240 (= K488)
- binding uridine-diphosphate-n-acetylglucosamine: R24 (= R273), G36 (= G285), G126 (≠ A375), V128 (≠ C377), S136 (≠ V385), T139 (≠ S388), C141 (≠ L390), G142 (≠ T391), V143 (≠ L392), H144 (≠ M393)
2puvA The crystal structure of isomerase domain of glucosamine-6-phosphate synthase from candida albicans (see paper)
40% identity, 57% coverage: 249:599/611 of query aligns to 1:338/338 of 2puvA
- active site: E237 (= E484), K241 (= K488), E244 (= E491)
- binding 5-amino-5-deoxy-1-o-phosphono-d-mannitol: C56 (= C303), T58 (= T305), S103 (= S350), Q104 (= Q351), S105 (= S352), T108 (= T355), A155 (= A403), E244 (= E491)
- binding uridine-diphosphate-n-acetylglucosamine: R25 (= R273), G37 (= G285), G127 (≠ A375), V129 (≠ C377), S137 (≠ V385), T140 (≠ S388), C142 (≠ L390), G143 (≠ T391), V144 (≠ L392), H145 (≠ M393)
Query Sequence
>WP_086509029.1 NCBI__GCF_002151265.1:WP_086509029.1
MCGIVGAVAQRNVEGILLEGLRRLEYRGYDSAGMAVISLDDELQRRRALGKVAALETMLN
EAALPGRCGIAHTRWATHGKPSEENAHPHQSGSRLALVHNGIIENHEPLRRELEADGYVF
SSQTDTEVVAHLLEREYRRGDGLLAAVQRGLARLEGAYALAVVHADEPDVVVGARKGSPL
VVGVGIDEAFLGSDPLALLQVTDRFIYLQEGDVVRLSDGGRIEIRDAQGQAAQRETHTFE
HGDGAASKGEYRHYMLKEIYEQPAVIAAALEGRLSERAVPVECFGPDAEALFERVKQVHI
VACGTSYHAGLVARYWLERYADIPVQVEVASEYRYRTVVVPDDTLFVTLSQSGETADTLA
ALRFARERGYLGSLAICNVPGSSLVRESDLTLMTQAGPEIGVASTKAFTTQLTALMLLTL
ALGRVKGLAAETQAELVAGLRSLPQLVGQVLKLDDAIERLSTAFAEKHHALFLGRGAHFP
IALEGALKLKEISYIHAEAYPAGELKHGPLALVDSEMPVISVAPNDELLDKLKSNLQEVR
ARGGELFVFADEQVGIVEEDGVRVLHLPHVHDALAPILYTVPLQLLSYHVAVLKGTDVDQ
PRNLAKSVTVE
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory