Comparing WP_086509037.1 NCBI__GCF_002151265.1:WP_086509037.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4petA Crystal structure of a trap periplasmic solute binding protein from colwellia psychrerythraea (cps_0129, target efi-510097) with bound calcium and pyruvate (see paper)
39% identity, 89% coverage: 34:354/362 of query aligns to 6:326/329 of 4petA
5cm6A Crystal structure of a trap periplasmic solute binding protein from pseudoalteromonas atlantica t6c(patl_2292, target efi-510180) with bound sodium and pyruvate
38% identity, 90% coverage: 34:359/362 of query aligns to 5:330/331 of 5cm6A
7ug8B Crystal structure of a solute receptor from synechococcus cc9311 in complex with alpha-ketovaleric and calcium
38% identity, 88% coverage: 32:351/362 of query aligns to 5:323/330 of 7ug8B
Q3J1R2 Alpha-keto acid-binding periplasmic protein TakP; Extracytoplasmic solute receptor protein TakP; TRAP transporter alpha-keto acid-binding subunit P; TRAP-T family sorbitol/mannitol transporter, periplasmic binding protein, SmoM from Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.) (Rhodobacter sphaeroides) (see paper)
35% identity, 98% coverage: 1:353/362 of query aligns to 1:352/365 of Q3J1R2
2hzlB Crystal structures of a sodium-alpha-keto acid binding subunit from a trap transporter in its closed forms (see paper)
35% identity, 89% coverage: 32:353/362 of query aligns to 4:324/337 of 2hzlB
4yicA Crystal structure of a trap transporter solute binding protein (ipr025997) from bordetella bronchiseptica rb50 (bb0280, target efi- 500035) with bound picolinic acid
36% identity, 86% coverage: 28:339/362 of query aligns to 1:311/344 of 4yicA
Q5SK82 Lactate-binding periplasmic protein TTHA0766; ABC transporter, solute-binding protein; Extracytoplasmic solute receptor protein TTHA0766; TRAP transporter lactate-binding subunit P from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see paper)
30% identity, 72% coverage: 1:262/362 of query aligns to 4:269/361 of Q5SK82
Sites not aligning to the query:
2zzwA Crystal structure of a periplasmic substrate binding protein in complex with zinc and lactate (see paper)
31% identity, 58% coverage: 54:262/362 of query aligns to 24:238/330 of 2zzwA
2zzvA Crystal structure of a periplasmic substrate binding protein in complex with calcium and lactate (see paper)
31% identity, 58% coverage: 54:262/362 of query aligns to 24:238/330 of 2zzvA
4pe3A Crystal structure of a trap periplasmic solute binding protein from rhodobacter sphaeroides (rsph17029_3620, target efi-510199), apo open structure (see paper)
27% identity, 65% coverage: 52:288/362 of query aligns to 20:256/315 of 4pe3A
Sites not aligning to the query:
4xf5A Crystal structure of a trap periplasmic solute binding protein from chromohalobacter salexigens dsm 3043 (csal_0678), target efi-501078, with bound (s)-(+)-2-amino-1-propanol.
26% identity, 78% coverage: 60:343/362 of query aligns to 29:308/317 of 4xf5A
Sites not aligning to the query:
4uabA Crystal structure of a trap periplasmic solute binding protein from chromohalobacter salexigens dsm 3043 (csal_0678), target efi-501078, with bound ethanolamine (see paper)
26% identity, 78% coverage: 60:343/362 of query aligns to 28:307/315 of 4uabA
Sites not aligning to the query:
7e9yA Crystal structure of elacco1 (see paper)
29% identity, 44% coverage: 54:211/362 of query aligns to 24:182/563 of 7e9yA
Sites not aligning to the query:
4xfeA Crystal structure of a trap periplasmic solute binding protein from pseudomonas putida f1 (pput_1203), target efi-500184, with bound d- glucuronate
26% identity, 65% coverage: 41:275/362 of query aligns to 10:242/306 of 4xfeA
Sites not aligning to the query:
4x8rA Crystal structure of a trap periplasmic solute binding protein from rhodobacter sphaeroides (rsph17029_2138, target efi-510205) with bound glucuronate
25% identity, 67% coverage: 32:273/362 of query aligns to 4:242/304 of 4x8rA
4n6dA Crystal structure of a trap periplasmic solute binding protein from desulfovibrio salexigens dsm2638 (desal_3247), target efi-510112, phased with i3c, open complex, c-terminus of symmetry mate bound in ligand binding site (see paper)
24% identity, 63% coverage: 43:270/362 of query aligns to 9:233/319 of 4n6dA
7bcrA Crystal structure of the sugar acid binding protein dctpam from advenella mimigardefordensis strain dpn7t in complex with galactonate (see paper)
24% identity, 75% coverage: 48:318/362 of query aligns to 20:287/310 of 7bcrA
Sites not aligning to the query:
7bcpA Crystal structure of the sugar acid binding protein dctpam from advenella mimigardefordensis strain dpn7t in complex with gluconate (see paper)
24% identity, 75% coverage: 48:318/362 of query aligns to 20:287/310 of 7bcpA
Sites not aligning to the query:
7bcoA Crystal structure of the sugar acid binding protein dctpam from advenella mimigardefordensis strain dpn7t in complex with d-foconate (see paper)
24% identity, 75% coverage: 48:318/362 of query aligns to 20:287/310 of 7bcoA
Sites not aligning to the query:
7bcnA Crystal structure of the sugar acid binding protein dctpam from advenella mimigardefordensis strain dpn7t in complex with xylonic acid (see paper)
24% identity, 75% coverage: 48:318/362 of query aligns to 20:287/310 of 7bcnA
>WP_086509037.1 NCBI__GCF_002151265.1:WP_086509037.1
MQRRKFLKTAGLGAAGVVAAPFVSTAKAQETITWDMVTSWPTNFPALGTGANAFAQRIEQ
LSNGRMRVRVHGAGELVPAMEVFDAVAAGTAEMGHSAAYYWRGKVAASQFFTAVPFGMNT
TEMNAWLYHGGGQELWDEIYAKHNLKPFAVGNTGAQMAGWFKREINSLADMQGIRLRLPG
LAGEAMNGIGVTTVNMPGGEIFTSMQTGVLDAADWVGPYNDMAFGLHQVADYYYTSPWNE
PTAVLEGTVNLDAWNALPDDLKAVVREAAKASNLDMISEFAYRNAQALATLVEEHGVQLR
TFPQDVIEALYESSQRVILQQVENDPDSAKVYESYSAFQALVRPFSDVGEFEYLKTRDTV
VT
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory