Comparing WP_086509072.1 NCBI__GCF_002151265.1:WP_086509072.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q9UBR1 Beta-ureidopropionase; BUP-1; Beta-alanine synthase; N-carbamoyl-beta-alanine amidohydrolase; EC 3.5.1.6 from Homo sapiens (Human) (see 4 papers)
39% identity, 97% coverage: 6:283/288 of query aligns to 74:367/384 of Q9UBR1
Sites not aligning to the query:
5h8iC Crystal structure of medicago truncatula n-carbamoylputrescine amidohydrolase (mtcpa) in complex with n-(dihydroxymethyl)putrescine (see paper)
39% identity, 87% coverage: 35:284/288 of query aligns to 32:291/301 of 5h8iC
5h8jB Crystal structure of medicago truncatula n-carbamoylputrescine amidohydrolase (mtcpa) in complex with cadaverine (see paper)
39% identity, 87% coverage: 35:284/288 of query aligns to 28:287/297 of 5h8jB
Q964D8 Beta-ureidopropionase; Beta-alanine synthase; N-carbamoyl-beta-alanine amidohydrolase; EC 3.5.1.6 from Dictyostelium discoideum (Social amoeba)
36% identity, 98% coverage: 6:286/288 of query aligns to 77:374/391 of Q964D8
Sites not aligning to the query:
5h8lB Crystal structure of medicago truncatula n-carbamoylputrescine amidohydrolase (mtcpa) c158s mutant in complex with putrescine (see paper)
39% identity, 87% coverage: 35:284/288 of query aligns to 29:288/298 of 5h8lB
3klcB Crystal structure of hyperthermophilic nitrilase (see paper)
36% identity, 86% coverage: 35:283/288 of query aligns to 25:261/261 of 3klcB
3klcA Crystal structure of hyperthermophilic nitrilase (see paper)
36% identity, 86% coverage: 35:283/288 of query aligns to 25:261/261 of 3klcA
Sites not aligning to the query:
Q9UYV8 Nitrilase; PaNit; EC 3.5.5.1 from Pyrococcus abyssi (strain GE5 / Orsay) (see paper)
36% identity, 86% coverage: 35:283/288 of query aligns to 26:262/262 of Q9UYV8
7ovgA The c146a variant of an amidase from pyrococcus horikoshii with bound acetamide (see paper)
33% identity, 97% coverage: 4:283/288 of query aligns to 3:263/263 of 7ovgA
6ypaB The c146a variant of an amidase from pyrococcus horikoshii with bound glutaramide
35% identity, 86% coverage: 35:283/288 of query aligns to 33:269/269 of 6ypaB
Q44185 N-carbamoyl-D-amino acid hydrolase; D-N-alpha-carbamilase; EC 3.5.1.77 from Rhizobium radiobacter (Agrobacterium tumefaciens) (Agrobacterium radiobacter) (see paper)
30% identity, 92% coverage: 22:286/288 of query aligns to 18:303/304 of Q44185
8hpcC Crystal structure of c171a mutant of n-carbamyl-d-amino acid amidohydrolase complexed with n-carbamyl-d-hydroxyphenylglycine
30% identity, 88% coverage: 33:286/288 of query aligns to 28:302/303 of 8hpcC
Q9NQR4 Omega-amidase NIT2; Nitrilase homolog 2; EC 3.5.1.3 from Homo sapiens (Human) (see 2 papers)
29% identity, 98% coverage: 1:282/288 of query aligns to 1:270/276 of Q9NQR4
1uf8A Crystal structure of c171a/v236a mutant of n-carbamyl-d-amino acid amidohydrolase complexed with n-carbamyl-d-phenylalanine
29% identity, 88% coverage: 33:286/288 of query aligns to 28:302/303 of 1uf8A
1uf7A Crystal structure of c171a/v236a mutant of n-carbamyl-d-amino acid amidohydrolase complexed with n-carbamyl-d-valine
29% identity, 88% coverage: 33:286/288 of query aligns to 28:302/303 of 1uf7A
1uf5A Crystal structure of c171a/v236a mutant of n-carbamyl-d-amino acid amidohydrolase complexed with n-carbamyl-d-methionine
29% identity, 88% coverage: 33:286/288 of query aligns to 28:302/303 of 1uf5A
Q94JV5 Deaminated glutathione amidase, chloroplastic/cytosolic; dGSH amidase; Nitrilase-like protein 2; Protein nitrilase 1 homolog; AtNit1; Protein Nit1 homolog; EC 3.5.1.128 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
26% identity, 84% coverage: 35:276/288 of query aligns to 60:302/307 of Q94JV5
Sites not aligning to the query:
P47016 Deaminated glutathione amidase; dGSH amidase; Nitrilase homolog 1; EC 3.5.1.128 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
28% identity, 60% coverage: 108:281/288 of query aligns to 110:306/307 of P47016
4hg5A Structural insights into yeast nit2: wild-type yeast nit2 in complex with oxaloacetate (see paper)
28% identity, 60% coverage: 108:281/288 of query aligns to 107:303/304 of 4hg5A
4hg3A Structural insights into yeast nit2: wild-type yeast nit2 in complex with alpha-ketoglutarate (see paper)
28% identity, 60% coverage: 108:281/288 of query aligns to 107:303/304 of 4hg3A
>WP_086509072.1 NCBI__GCF_002151265.1:WP_086509072.1
MQKMTIGLIQMGLKTSTDLEPAAIRDAMNEAHLPLIQQAAQAGVQVLCFQEVFNQPYFCP
SQDPKWYAAAERVPDGPTCRMMQKLAAEHRMVMIVPIYEETVTGVYYNSAAVFDADGSYL
GKYHKTHIPQVAGFWEKFFFKPGRSGWPVFDTAYGKIGVYICYDRHFPEGWRALALNGAE
VIFNPSATVAGLSQYLWELEQPASAAANGCFIAAINRVGSEAPWNIGEFYGSSYIVNPRG
QIEAQASDRADELLVHEIDLAMVREIRNNWQFFRDRRPEAYGRLTDGE
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory