Comparing WP_086509083.1 NCBI__GCF_002151265.1:WP_086509083.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 11 hits to proteins with known functional sites (download)
8w78A Structure of drosophila melanogaster l-2-hydroxyglutarate dehydrogenase in complex with fad and 2-oxoglutarate (see paper)
41% identity, 95% coverage: 15:392/399 of query aligns to 16:403/410 of 8w78A
Sites not aligning to the query:
8w7fB Structure of drosophila melanogaster l-2-hydroxyglutarate dehydrogenase bound with fad and a sulfate ion (see paper)
41% identity, 95% coverage: 15:392/399 of query aligns to 16:405/412 of 8w7fB
Sites not aligning to the query:
3dmeA Crystal structure of conserved exported protein from bordetella pertussis. Northeast structural genomics target ber141
31% identity, 67% coverage: 3:268/399 of query aligns to 4:271/366 of 3dmeA
Sites not aligning to the query:
4x9mA Oxidized l-alpha-glycerophosphate oxidase from mycoplasma pneumoniae with fad bound (see paper)
27% identity, 69% coverage: 3:279/399 of query aligns to 5:286/384 of 4x9mA
Sites not aligning to the query:
P75063 Glycerol 3-phosphate oxidase; GlpO; L-alpha-glycerophosphate oxidase; EC 1.1.3.21 from Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1) (Mycoplasmoides pneumoniae) (see paper)
27% identity, 69% coverage: 3:279/399 of query aligns to 5:286/384 of P75063
Sites not aligning to the query:
Q9AGP8 Dimethylglycine oxidase; DMGO; EC 1.5.3.10 from Arthrobacter globiformis (see 2 papers)
25% identity, 52% coverage: 4:211/399 of query aligns to 7:215/830 of Q9AGP8
Sites not aligning to the query:
1pj7A Structure of dimethylglycine oxidase of arthrobacter globiformis in complex with folinic acid (see paper)
25% identity, 52% coverage: 4:211/399 of query aligns to 4:212/827 of 1pj7A
Sites not aligning to the query:
3gsiA Crystal structure of d552a dimethylglycine oxidase mutant of arthrobacter globiformis in complex with tetrahydrofolate (see paper)
25% identity, 52% coverage: 4:211/399 of query aligns to 4:212/827 of 3gsiA
Sites not aligning to the query:
1pj6A Crystal structure of dimethylglycine oxidase of arthrobacter globiformis in complex with folic acid (see paper)
25% identity, 52% coverage: 4:211/399 of query aligns to 5:213/828 of 1pj6A
Sites not aligning to the query:
7cyxA Crystal strcuture of glycine oxidase from bacillus cereus atcc 14579 (see paper)
26% identity, 56% coverage: 2:224/399 of query aligns to 2:223/363 of 7cyxA
Sites not aligning to the query:
Q8GAI3 4-methylaminobutanoate oxidase (formaldehyde-forming); MABO; Demethylating gamma-N-methylaminobutyrate oxidase; Gamma-N-methylaminobutyrate oxidase 1; EC 1.5.3.19 from Paenarthrobacter nicotinovorans (Arthrobacter nicotinovorans) (see paper)
27% identity, 49% coverage: 5:201/399 of query aligns to 29:226/824 of Q8GAI3
>WP_086509083.1 NCBI__GCF_002151265.1:WP_086509083.1
MYDFIILGGGILGLSTAMQLIERYPEKKMLLLEKESGPAQHQTGHNSGVIHAGVYYAPGS
LKARFCLEGNRATKEFCDRHAIPYEVCGKLLVATNEQEMQRMEALWERTAANGLEREWLS
AGELKEREPHITGQGAIFVPSSGIVSYARVAEAMADEFQRHGGQIRYDHHVTGLAERTGE
VIVGTSQGEFNSRYLVTCSGLMADRVVRLLGRDPGFTICPFRGEYYRLPDRHSDIVKHLI
YPIPDPSMPFLGVHLTRMIDGSVTVGPNAVLALKREGYRKSDVSLVDMARMFSNPGILKV
LGRNLRPGIHELKNSLWRRGYLEEVRKYCPSLTLDDLEPWPAGVRAQAVSRDGRLIDDFL
FVNTRRTVNVCNAPSPAATSALPIGRHILDKVSAMVQSS
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory