SitesBLAST
Comparing WP_086509091.1 NCBI__GCF_002151265.1:WP_086509091.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4tkmB Crystal structure of nadh-dependent reductase a1-r' complexed with nad (see paper)
44% identity, 100% coverage: 1:254/254 of query aligns to 1:241/241 of 4tkmB
- active site: G18 (= G18), S150 (= S145), Y164 (= Y159), K168 (= K163)
- binding nicotinamide-adenine-dinucleotide: G14 (= G14), T16 (≠ S16), E17 (≠ R17), I19 (= I19), S38 (≠ Y38), H39 (= H39), I66 (≠ L66), N92 (= N92), G94 (= G94), T148 (= T143), S150 (= S145), Y164 (= Y159), K168 (= K163), G195 (= G190), T196 (= T191)
3afnB Crystal structure of aldose reductase a1-r complexed with NADP (see paper)
46% identity, 98% coverage: 2:251/254 of query aligns to 1:254/257 of 3afnB
- active site: G17 (= G18), S149 (= S145), I150 (= I146), A160 (= A156), Y163 (= Y159), K167 (= K163)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G14), Q16 (≠ R17), G17 (= G18), H36 (= H37), R38 (≠ H39), D64 (= D65), L65 (= L66), N91 (= N92), A92 (= A93), G93 (= G94), T147 (= T143), S149 (= S145), Y163 (= Y159), K167 (= K163), P193 (= P189), G194 (= G190), T195 (= T191), V196 (≠ I192), T198 (= T194), F200 (= F196), H201 (= H197)
8bcjB Crystal structure of short-chain dehydrogenase pa3128 from pseudomonas aeruginosa pao1 in complex with NADP+
41% identity, 95% coverage: 10:251/254 of query aligns to 7:250/250 of 8bcjB
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G11 (= G14), S13 (= S16), R14 (= R17), G15 (= G18), I16 (= I19), L36 (≠ H39), R37 (≠ A40), N38 (≠ S41), A61 (≠ G64), D62 (= D65), V63 (≠ L66), N89 (= N92), A90 (= A93), G91 (= G94), T113 (≠ L116), V143 (≠ T143), S145 (= S145), Y159 (= Y159), K163 (= K163), P189 (= P189), G190 (= G190), I192 (= I192), T194 (= T194), I196 (≠ F196), H197 (= H197)
P73574 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-acyl carrier protein reductase; EC 1.1.1.100 from Synechocystis sp. (strain PCC 6803 / Kazusa) (see paper)
39% identity, 96% coverage: 11:253/254 of query aligns to 10:246/247 of P73574
- A14 (= A15) mutation to G: 4.2-fold increase in activity on acetoacetyl-CoA.
- P151 (= P154) mutation to F: 2.7-fold increase in activity on acetoacetyl-CoA.; mutation to V: 5.7-fold increase in activity on acetoacetyl-CoA.
- K160 (= K163) mutation to A: Almost no activity on acetoacetyl-CoA.
- F188 (≠ T191) mutation to Y: 3.3-fold increase in activity on acetoacetyl-CoA.
- N198 (≠ S201) mutation to R: 3.5-fold increase in activity on acetoacetyl-CoA.
3ijrF 2.05 angstrom resolution crystal structure of a short chain dehydrogenase from bacillus anthracis str. 'Ames ancestor' in complex with NAD+
36% identity, 98% coverage: 3:250/254 of query aligns to 42:285/290 of 3ijrF
- active site: G57 (= G18), S182 (= S145), L192 (≠ G155), Y195 (= Y159), K199 (= K163), K240 (≠ A204)
- binding magnesium ion: D55 (≠ S16), S56 (≠ R17), E80 (≠ S41)
- binding nicotinamide-adenine-dinucleotide: D55 (≠ S16), S56 (≠ R17), G57 (= G18), I58 (= I19), Y77 (= Y38), L78 (≠ H39), E80 (≠ S41), G103 (= G64), D104 (= D65), L105 (= L66), N131 (= N92), V132 (≠ A93), A133 (≠ G94), Q134 (≠ D95), I155 (≠ L116), T180 (= T143), S182 (= S145), Y195 (= Y159), K199 (= K163), P225 (= P189), G226 (= G190), P227 (≠ T191), I228 (= I192), T230 (= T194), L232 (≠ F196)
Sites not aligning to the query:
3i3oA 2.06 angstrom resolution crystal structure of a short chain dehydrogenase from bacillus anthracis str. 'Ames ancestor' in complex with NAD-acetone
36% identity, 98% coverage: 3:250/254 of query aligns to 34:277/282 of 3i3oA
- active site: G49 (= G18), S174 (= S145), L184 (≠ G155), Y187 (= Y159), K191 (= K163), K232 (≠ A204)
- binding magnesium ion: D47 (≠ S16), S48 (≠ R17), E72 (≠ S41)
- binding nicotinamide adenine dinucleotide acetone adduct: G45 (= G14), D47 (≠ S16), S48 (≠ R17), G49 (= G18), I50 (= I19), Y69 (= Y38), L70 (≠ H39), E72 (≠ S41), G95 (= G64), D96 (= D65), L97 (= L66), N123 (= N92), V124 (≠ A93), A125 (≠ G94), Q126 (≠ D95), Q127 (≠ M96), I147 (≠ L116), T172 (= T143), S174 (= S145), Y187 (= Y159), K191 (= K163), P217 (= P189), G218 (= G190), I220 (= I192), T222 (= T194), L224 (≠ F196)
3osuA Crystal structure of the 3-oxoacyl-acyl carrier protein reductase, fabg, from staphylococcus aureus
37% identity, 97% coverage: 8:253/254 of query aligns to 5:246/246 of 3osuA
7v0hG Crystal structure of putative glucose 1-dehydrogenase from burkholderia cenocepacia in complex with NADP and a potential reaction product
36% identity, 98% coverage: 2:250/254 of query aligns to 6:251/253 of 7v0hG
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G18 (= G14), S20 (= S16), K21 (≠ R17), G22 (= G18), I23 (= I19), A43 (≠ H39), S44 (≠ A40), S45 (= S41), G68 (= G64), D69 (= D65), V70 (≠ L66), N96 (= N92), S97 (≠ A93), G98 (= G94), Y100 (≠ L97), I144 (≠ T143), S146 (= S145), Y159 (= Y159), K163 (= K163), P189 (= P189), G190 (= G190), M191 (≠ T191), I192 (= I192), T194 (= T194), G196 (≠ A207), T197 (= T208)
- binding (2R)-2-(hydroxymethyl)pentanedioic acid: S146 (= S145), Y159 (= Y159), M191 (≠ T191), I202 (= I213)
3sj7A Structure of beta-ketoacetyl-coa reductase (fabg) from staphylococcus aureus complex with NADPH (see paper)
37% identity, 97% coverage: 8:253/254 of query aligns to 2:239/239 of 3sj7A
- active site: G12 (= G18), S138 (= S145), Q148 (≠ A156), Y151 (= Y159), K155 (= K163)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G8 (= G14), S10 (= S16), R11 (= R17), I13 (= I19), N31 (≠ H37), Y32 (= Y38), A33 (≠ H39), G34 (≠ A40), S35 (= S41), A58 (≠ G64), N59 (≠ D65), V60 (≠ L66), N86 (= N92), A87 (= A93), T109 (≠ L116), S138 (= S145), Y151 (= Y159), K155 (= K163), P181 (= P189), G182 (= G190)
4iqgD Crystal structure of bpro0239 oxidoreductase from polaromonas sp. Js666 in NADP bound form
40% identity, 96% coverage: 8:251/254 of query aligns to 3:248/248 of 4iqgD
- active site: G13 (= G18), N112 (= N117), S143 (= S145), Y154 (≠ G157), Y157 (= Y159), K161 (= K163)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G9 (= G14), S11 (= S16), R12 (= R17), G13 (= G18), I14 (= I19), N32 (≠ H37), A34 (≠ H39), S35 (≠ A40), N36 (≠ S41), A59 (≠ G64), D60 (= D65), V61 (≠ L66), N87 (= N92), A88 (= A93), G89 (= G94), V141 (≠ T143), S143 (= S145), Y157 (= Y159), K161 (= K163), P187 (= P189), G188 (= G190), I190 (= I192), T192 (= T194), I194 (≠ F196), H195 (= H197)
7krmC Putative fabg bound to nadh from acinetobacter baumannii
36% identity, 98% coverage: 5:253/254 of query aligns to 3:243/244 of 7krmC
- active site: G18 (= G18), S140 (= S145), Y155 (= Y159)
- binding nicotinamide-adenine-dinucleotide: G12 (= G14), S15 (vs. gap), G18 (= G18), I19 (= I19), D38 (≠ H39), L39 (≠ A40), A60 (≠ G64), N61 (≠ D65), V62 (≠ L66), N88 (= N92), V111 (≠ L116), S140 (= S145), Y155 (= Y159), K159 (= K163), I188 (= I192), T190 (= T194)
4jroC Crystal structure of 3-oxoacyl-[acyl-carrier protein]reductase (fabg) from listeria monocytogenes in complex with NADP+
36% identity, 98% coverage: 6:253/254 of query aligns to 4:247/247 of 4jroC
- active site: G16 (= G18), S142 (= S145), Q152 (≠ A156), Y155 (= Y159), K159 (= K163)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G14), S14 (= S16), R15 (= R17), G16 (= G18), I17 (= I19), N35 (≠ H37), Y36 (= Y38), N37 (≠ H39), G38 (≠ A40), S39 (= S41), N63 (≠ D65), V64 (≠ L66), N90 (= N92), A91 (= A93), I93 (vs. gap), I113 (≠ L116), S142 (= S145), Y155 (= Y159), K159 (= K163), P185 (= P189), I188 (= I192), T190 (= T194)
1edoA The x-ray structure of beta-keto acyl carrier protein reductase from brassica napus complexed with NADP+ (see paper)
36% identity, 95% coverage: 10:250/254 of query aligns to 4:241/244 of 1edoA
- active site: G12 (= G18), S138 (= S145), Y151 (= Y159), K155 (= K163)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G14), S10 (= S16), R11 (= R17), I13 (= I19), N31 (≠ H37), Y32 (= Y38), A33 (≠ H39), R34 (≠ A40), S35 (= S41), D59 (= D65), V60 (≠ L66), N86 (= N92), A87 (= A93), S138 (= S145), Y151 (= Y159), K155 (= K163), P181 (= P189), G182 (= G190), I184 (= I192), S186 (≠ T194), M188 (≠ F196)
4dmmB 3-oxoacyl-[acyl-carrier-protein] reductase from synechococcus elongatus pcc 7942 in complex with NADP
44% identity, 96% coverage: 11:253/254 of query aligns to 9:239/240 of 4dmmB
- active site: G16 (= G18), S142 (= S145), Q152 (≠ A156), Y155 (= Y159), K159 (= K163)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G14), S14 (= S16), R15 (= R17), G16 (= G18), I17 (= I19), A37 (≠ H39), S38 (≠ A40), S39 (= S41), A62 (≠ G64), D63 (= D65), V64 (≠ L66), N90 (= N92), A91 (= A93), L113 (= L116), I140 (≠ T143), S142 (= S145), Y155 (= Y159), K159 (= K163), P185 (= P189), G186 (= G190), I188 (= I192), T190 (= T194), M192 (≠ L206)
7yb2D Crystal structure of anthrol reductase (cbar) in complex with NADP+ and emodin (see paper)
35% identity, 96% coverage: 7:250/254 of query aligns to 12:262/264 of 7yb2D
- binding 3-methyl-1,6,8-trihydroxyanthraquinone: S147 (= S145), Y161 (= Y159), G193 (≠ T191), M198 (≠ F196), F199 (vs. gap), V202 (vs. gap), S203 (vs. gap), Y206 (≠ V198)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G19 (= G14), R22 (= R17), G23 (= G18), I24 (= I19), Y43 (= Y38), A44 (≠ H39), N45 (≠ A40), S46 (= S41), D70 (= D65), V71 (≠ L66), N97 (= N92), S98 (≠ A93), L120 (= L116), T145 (= T143), S147 (= S145), Y161 (= Y159), K165 (= K163), P191 (= P189), G192 (= G190), T194 (≠ I192), T196 (= T194), M198 (≠ F196)
8hfjC Crystal structure of cbar mutant (h162f) in complex with NADP+ and a bulky 1,3-cyclodiketone (see paper)
35% identity, 96% coverage: 7:250/254 of query aligns to 8:258/260 of 8hfjC
- binding 2-methyl-2-[(4-methylphenyl)methyl]cyclopentane-1,3-dione: N144 (≠ I146), T145 (≠ A147), F154 (≠ A156), G189 (≠ T191), V198 (vs. gap)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G15 (= G14), R18 (= R17), I20 (= I19), Y39 (= Y38), A40 (≠ H39), N41 (≠ A40), S42 (= S41), D66 (= D65), V67 (≠ L66), N93 (= N92), S94 (≠ A93), L116 (= L116), T141 (= T143), Y157 (= Y159), K161 (= K163), P187 (= P189), T190 (≠ I192), T192 (= T194), M194 (≠ F196)
Sites not aligning to the query:
5jydB Crystal structure of a putative short chain dehydrogenase from burkholderia cenocepacia
38% identity, 96% coverage: 7:250/254 of query aligns to 47:288/292 of 5jydB
- active site: G58 (= G18), S184 (= S145), L194 (= L158), Y197 (= Y159), K201 (= K163), P242 (≠ A204)
- binding magnesium ion: D56 (≠ S16), S57 (≠ R17), E82 (≠ S42)
- binding nicotinamide-adenine-dinucleotide: G54 (= G14), D56 (≠ S16), S57 (≠ R17), G58 (= G18), I59 (= I19), L79 (≠ H39), E82 (≠ S42), D106 (= D65), I107 (≠ L66), N133 (= N92), A134 (= A93), A135 (≠ G94), T182 (= T143), S184 (= S145), Y197 (= Y159), K201 (= K163), P227 (= P189), G228 (= G190), P229 (≠ T191), Y230 (≠ I192), T232 (= T194), L234 (≠ F196), Q235 (≠ H197)
4fj0D Crystal structure of the ternary complex between a fungal 17beta- hydroxysteroid dehydrogenase (holo form) and 3,7-dihydroxy flavone (see paper)
34% identity, 96% coverage: 7:250/254 of query aligns to 9:259/261 of 4fj0D
- active site: G20 (= G18), S144 (= S145), N145 (≠ I146), H155 (≠ A156), Y158 (= Y159), K162 (= K163), Y203 (vs. gap)
- binding 3,7-dihydroxy-2-phenyl-4H-chromen-4-one: S144 (= S145), N145 (≠ I146), G190 (≠ T191), F196 (= F196), S200 (vs. gap), Y203 (vs. gap), A219 (= A209)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G16 (= G14), R19 (= R17), G20 (= G18), I21 (= I19), A41 (≠ H39), N42 (≠ A40), S43 (= S41), I68 (≠ L66), N94 (= N92), S95 (≠ A93), G96 (= G94), L117 (= L116), T142 (= T143), Y158 (= Y159), K162 (= K163), P188 (= P189), G189 (= G190), G190 (≠ T191), T191 (≠ I192), T193 (= T194), M195 (vs. gap)
4fj2B Crystal structure of the ternary complex between a fungal 17beta- hydroxysteroid dehydrogenase (holo form) and biochanin a (see paper)
34% identity, 96% coverage: 7:250/254 of query aligns to 8:258/260 of 4fj2B
- active site: G19 (= G18), S143 (= S145), N144 (≠ I146), H154 (≠ A156), Y157 (= Y159), K161 (= K163), Y202 (vs. gap)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G15 (= G14), R18 (= R17), G19 (= G18), I20 (= I19), A40 (≠ H39), N41 (≠ A40), S42 (= S41), I67 (≠ L66), N93 (= N92), S94 (≠ A93), G95 (= G94), L116 (= L116), T141 (= T143), Y157 (= Y159), K161 (= K163), G188 (= G190), G189 (≠ T191), T190 (≠ I192), T192 (= T194), M194 (vs. gap)
- binding 5,7-dihydroxy-3-(4-methoxyphenyl)-4H-chromen-4-one: G189 (≠ T191), F195 (= F196), V198 (vs. gap), S199 (vs. gap), Y202 (vs. gap), I203 (vs. gap), M217 (≠ T208), A218 (= A209)
3qwiA Crystal structure of a 17beta-hydroxysteroid dehydrogenase (holo form) from fungus cochliobolus lunatus in complex with NADPH and coumestrol (see paper)
34% identity, 96% coverage: 7:250/254 of query aligns to 8:258/260 of 3qwiA
- active site: G19 (= G18), S143 (= S145), N144 (≠ I146), H154 (≠ A156), Y157 (= Y159), K161 (= K163), Y202 (vs. gap)
- binding Coumestrol: F149 (≠ G151), G189 (≠ T191), M194 (vs. gap), Y202 (vs. gap), I203 (vs. gap), A218 (= A209)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G15 (= G14), R18 (= R17), I20 (= I19), A40 (≠ H39), N41 (≠ A40), S42 (= S41), I67 (≠ L66), N93 (= N92), S94 (≠ A93), G95 (= G94), L116 (= L116), T141 (= T143), Y157 (= Y159), K161 (= K163), P187 (= P189), G188 (= G190), G189 (≠ T191), T190 (≠ I192), T192 (= T194), M194 (vs. gap)
Query Sequence
>WP_086509091.1 NCBI__GCF_002151265.1:WP_086509091.1
MFEEWKGKRVLVTGASRGIGAAVARRMGALGASVAVHYHASSEAAEEVVKAIRTAGGEAF
ALTGDLSRSSEAQRVVDEAAERLGGLELLINNAGDMLGRVALEEIDDAHYDRVMDLNARS
VVMVTRAALPHFRHAGGGNVIHTTSIAARNGGGPGAGLYAAAKGFVSTLTRNMAKELAAE
RIRVNAVAPGTIATDFHVRHSNEAHLATARAGIPMGRLGTAEECVGAYLFLGSESLSAYV
TGQVIEVNGGQLMP
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory