SitesBLAST
Comparing WP_086509118.1 NCBI__GCF_002151265.1:WP_086509118.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6tg9A Cryo-em structure of nadh reduced form of NAD+-dependent formate dehydrogenase from rhodobacter capsulatus (see paper)
68% identity, 95% coverage: 20:943/971 of query aligns to 7:938/949 of 6tg9A
- active site: K289 (= K294), C380 (= C385), H381 (= H386), L545 (= L550), G582 (= G587), Q583 (= Q588)
- binding fe2/s2 (inorganic) cluster: C51 (= C65), V59 (≠ F73), G60 (= G74), C62 (= C76), C65 (= C79), C79 (= C93)
- binding 2-amino-5,6-dimercapto-7-methyl-3,7,8a,9-tetrahydro-8-oxa-1,3,9,10-tetraaza-anthracen-4-one guanosine dinucleotide: C255 (= C260), K289 (= K294), R351 (= R356), C352 (= C357), C380 (= C385), G414 (= G419), A415 (= A420), D419 (= D424), G420 (≠ A425), H421 (= H426), P443 (= P448), R444 (= R449), P464 (= P469), N467 (= N472), L545 (= L550), G546 (= G551), H550 (= H555), G582 (= G587), Q583 (= Q588), Q583 (= Q588), G649 (= G654), E650 (= E655), S655 (= S660), N680 (= N685), S693 (= S698), K698 (= K703), D724 (= D729), T820 (= T825), T821 (= T826), R823 (= R828), R823 (= R828), I824 (= I829), L825 (= L830), N829 (= N834), V830 (= V835), Q833 (= Q838), N902 (= N907), Y918 (= Y923), K919 (= K924)
- binding iron/sulfur cluster: H111 (= H125), C115 (= C129), C118 (= C132), A120 (= A134), C124 (= C138), C176 (= C180), I177 (= I181), V178 (= V182), C179 (= C183), M180 (≠ S184), C182 (= C186), C186 (= C190), I206 (≠ V210), C218 (= C223), S220 (= S225), C221 (= C226), G222 (= G227), C224 (= C229), C228 (= C233), T230 (= T235), A231 (≠ S236), C252 (= C257), Y254 (= Y259), C255 (= C260), V257 (= V262), C259 (= C264), F261 (= F266), C287 (= C292), K289 (= K294), V423 (= V428)
7vw6A Cryo-em structure of formate dehydrogenase 1 from methylorubrum extorquens am1 (see paper)
38% identity, 92% coverage: 33:930/971 of query aligns to 2:910/913 of 7vw6A
- binding fe2/s2 (inorganic) cluster: H32 (≠ K63), C34 (= C65), H35 (≠ A66), G45 (= G74), C47 (= C76), R48 (= R77), C50 (= C79), C64 (= C93)
- binding 2-amino-5,6-dimercapto-7-methyl-3,7,8a,9-tetrahydro-8-oxa-1,3,9,10-tetraaza-anthracen-4-one guanosine dinucleotide: K263 (= K294), K339 (≠ R356), C364 (= C381), C368 (= C385), G402 (= G419), N404 (= N421), N408 (≠ A425), D431 (= D447), P432 (= P448), R433 (= R449), F447 (≠ L467), G450 (= G470), D452 (≠ N472), G525 (= G549), M526 (≠ L550), G527 (= G551), Q530 (≠ E554), H531 (= H555), G563 (= G587), Q564 (= Q588), G630 (= G654), N632 (≠ D656), S636 (= S660), Q656 (= Q680), D657 (= D681), L658 (≠ I682), T805 (= T826), R807 (= R828), R807 (= R828), V808 (≠ I829), L809 (= L830), H811 (≠ Q832), W812 (≠ Y833), H813 (≠ N834), H813 (≠ N834), T814 (≠ V835), M817 (≠ Q838), F879 (= F899), N887 (= N907), F903 (≠ Y923), K904 (= K924)
- binding iron/sulfur cluster: C145 (= C180), I146 (= I181), Q147 (≠ V182), C148 (= C183), N149 (≠ S184), C151 (= C186), C155 (= C190), N161 (≠ T196), V163 (≠ A198), I164 (≠ L199), V175 (= V210), C188 (= C223), V189 (= V224), A190 (≠ S225), C191 (= C226), G192 (= G227), C194 (= C229), C198 (= C233), P199 (= P234), T200 (= T235), A202 (≠ T237), L203 (= L238), C227 (= C257), C230 (= C260), C234 (= C264), C261 (= C292), K263 (= K294), G264 (= G295), V411 (= V428)
1fdiA Oxidized form of formate dehydrogenase h from e. Coli complexed with the inhibitor nitrite (see paper)
39% identity, 72% coverage: 252:953/971 of query aligns to 3:709/715 of 1fdiA
- active site: C11 (= C260), L41 (≠ S291), C42 (= C292), K44 (= K294), S108 (= S354), R110 (= R356), D134 (= D379), C140 (= C385), H141 (= H386), S180 (≠ A425), M297 (≠ L550), R333 (= R586), G334 (= G587), Q335 (= Q588)
- binding 2-amino-5,6-dimercapto-7-methyl-3,7,8a,9-tetrahydro-8-oxa-1,3,9,10-tetraaza-anthracen-4-one guanosine dinucleotide: K44 (= K294), R110 (= R356), G111 (≠ C357), V139 (= V384), C140 (= C385), F173 (≠ I418), G174 (= G419), Y175 (≠ A420), N176 (= N421), D179 (= D424), S180 (≠ A425), C201 (≠ V446), D202 (= D447), P203 (= P448), R204 (= R449), L218 (= L467), G221 (= G470), N223 (= N472), G296 (= G549), M297 (≠ L550), G298 (= G551), F302 (≠ H555), G334 (= G587), Q335 (= Q588), Q335 (= Q588), G402 (= G654), E403 (= E655), T408 (≠ S660), Q428 (= Q680), D429 (= D681), I430 (= I682), S445 (≠ G697), D478 (= D729), T579 (= T826), V580 (≠ G827), R581 (= R828), R581 (= R828), E582 (≠ I829), H585 (≠ Q832), Y586 (= Y833), S587 (≠ N834), C588 (≠ V835), Y654 (≠ F899), N662 (= N907), Y678 (= Y923), K679 (= K924)
- binding nitrite ion: C140 (= C385), H141 (= H386), R333 (= R586), G334 (= G587), V338 (= V591)
- binding iron/sulfur cluster: C8 (= C257), Y10 (= Y259), C11 (= C260), S13 (≠ V262), C15 (= C264), L41 (≠ S291), C42 (= C292), K44 (= K294), P182 (= P427), I183 (≠ V428)
P07658 Formate dehydrogenase H; Formate dehydrogenase-H subunit alpha; FDH-H; Formate-hydrogen-lyase-linked, selenocysteine-containing polypeptide; EC 1.17.98.4 from Escherichia coli (strain K12) (see 2 papers)
39% identity, 72% coverage: 252:953/971 of query aligns to 3:709/715 of P07658
- C8 (= C257) binding
- Y10 (= Y259) binding
- C11 (= C260) binding
- C15 (= C264) binding
- C42 (= C292) binding
- K44 (= K294) binding
- U140 (≠ C385) modified: nonstandard, Selenocysteine
- M297 (≠ L550) binding
- Q301 (≠ E554) binding
- Q335 (= Q588) binding
- S445 (≠ G697) binding
- D478 (= D729) binding
- C588 (≠ V835) binding
- Y654 (≠ F899) binding
- Q655 (≠ H900) binding
- Y678 (= Y923) binding
- K679 (= K924) binding
2iv2X Reinterpretation of reduced form of formate dehydrogenase h from e. Coli (see paper)
39% identity, 72% coverage: 252:953/971 of query aligns to 3:691/697 of 2iv2X
- active site: C11 (= C260), L41 (≠ S291), C42 (= C292), K44 (= K294), S108 (= S354), C140 (= C385), H141 (= H386), S180 (≠ A425), M297 (≠ L550), R333 (= R586), G334 (= G587), Q335 (= Q588)
- binding guanylate-o'-phosphoric acidmono-(2-amino-5,6-dimercapto-4-oxo-3,5,6,7,8a,9,10,10a-octahydro-4h-8-oxa-1,3,9,10-tetraaza-anthracen-7-ylmethyl) ester: R110 (= R356), G111 (≠ C357), T112 (= T358), A137 (= A382), Q335 (= Q588), G402 (= G654), E403 (= E655), D404 (= D656), T408 (≠ S660), A410 (≠ P662), Q428 (= Q680), D429 (= D681), I430 (= I682), S445 (≠ G697), D478 (= D729), C588 (≠ V835), Y660 (= Y923)
- binding 2-amino-5,6-dimercapto-7-methyl-3,7,8a,9-tetrahydro-8-oxa-1,3,9,10-tetraaza-anthracen-4-one guanosine dinucleotide: K44 (= K294), F173 (≠ I418), G174 (= G419), Y175 (≠ A420), N176 (= N421), D179 (= D424), S180 (≠ A425), D202 (= D447), P203 (= P448), R204 (= R449), N223 (= N472), G296 (= G549), M297 (≠ L550), F302 (≠ H555), G334 (= G587), R581 (= R828), E582 (≠ I829), V583 (≠ L830), H585 (≠ Q832), Y586 (= Y833), S587 (≠ N834), K661 (= K924)
- binding iron/sulfur cluster: C8 (= C257), C11 (= C260), S13 (≠ V262), C15 (= C264), L41 (≠ S291), C42 (= C292), K44 (= K294), G45 (= G295), I183 (≠ V428)
7qv7S Cryo-em structure of hydrogen-dependent co2 reductase. (see paper)
40% identity, 60% coverage: 250:827/971 of query aligns to 1:571/571 of 7qv7S
7bkbD Formate dehydrogenase - heterodisulfide reductase - formylmethanofuran dehydrogenase complex from methanospirillum hungatei (hexameric, composite structure) (see paper)
37% identity, 57% coverage: 253:809/971 of query aligns to 7:546/549 of 7bkbD
2v45A A new catalytic mechanism of periplasmic nitrate reductase from desulfovibrio desulfuricans atcc 27774 from crystallographic and epr data and based on detailed analysis of the sixth ligand (see paper)
28% identity, 71% coverage: 248:932/971 of query aligns to 4:722/723 of 2v45A
- active site: K49 (= K294), S109 (= S354), C140 (= C385), M141 (≠ H386), A180 (= A425), M308 (≠ L550), T344 (≠ R586), G345 (= G587), Q346 (= Q588)
- binding 2-amino-5,6-dimercapto-7-methyl-3,7,8a,9-tetrahydro-8-oxa-1,3,9,10-tetraaza-anthracen-4-one guanosine dinucleotide: R14 (≠ A258), K49 (= K294), Q111 (≠ R356), C140 (= C385), G174 (= G419), N176 (= N421), E179 (≠ D424), A180 (= A425), D204 (= D447), P205 (= P448), R206 (= R449), P222 (= P469), D225 (≠ N472), C307 (≠ G549), M308 (≠ L550), G309 (= G551), Q312 (≠ E554), R313 (≠ H555), G345 (= G587), Q346 (= Q588), Q346 (= Q588), E416 (≠ G654), T417 (≠ E655), N418 (≠ D656), T422 (≠ S660), I443 (≠ Q680), E444 (≠ D681), A445 (≠ I682), F446 (= F683), P461 (≠ G697), F463 (≠ S699), S615 (≠ T826), M616 (≠ G827), R617 (= R828), R617 (= R828), V618 (≠ I829), I619 (≠ L830), H621 (≠ Q832), W622 (≠ Y833), H623 (≠ N834), H623 (≠ N834), T624 (≠ V835), T626 (≠ A837), F689 (= F899), N697 (= N907), Y713 (= Y923), K714 (= K924)
- binding iron/sulfur cluster: C13 (= C257), C16 (= C260), T18 (≠ V262), C20 (= C264), L46 (≠ S291), C47 (= C292), V183 (= V428)
2jirA A new catalytic mechanism of periplasmic nitrate reductase from desulfovibrio desulfuricans atcc 27774 from crystallographic and epr data and based on detailed analysis of the sixth ligand (see paper)
28% identity, 71% coverage: 248:932/971 of query aligns to 1:719/720 of 2jirA
- active site: K46 (= K294), S106 (= S354), C137 (= C385), M138 (≠ H386), A177 (= A425), M305 (≠ L550), T341 (≠ R586), G342 (= G587), Q343 (= Q588)
- binding 2-amino-5,6-dimercapto-7-methyl-3,7,8a,9-tetrahydro-8-oxa-1,3,9,10-tetraaza-anthracen-4-one guanosine dinucleotide: R11 (≠ A258), K46 (= K294), Q108 (≠ R356), C137 (= C385), G171 (= G419), S172 (≠ A420), N173 (= N421), E176 (≠ D424), A177 (= A425), D201 (= D447), P202 (= P448), R203 (= R449), F217 (≠ L467), D222 (≠ N472), C304 (≠ G549), M305 (≠ L550), G306 (= G551), Q309 (≠ E554), R310 (≠ H555), G342 (= G587), Q343 (= Q588), Q343 (= Q588), E413 (≠ G654), T414 (≠ E655), N415 (≠ D656), T419 (≠ S660), I440 (≠ Q680), E441 (≠ D681), A442 (≠ I682), P458 (≠ G697), F460 (≠ S699), S612 (≠ T826), M613 (≠ G827), R614 (= R828), R614 (= R828), I616 (≠ L830), H618 (≠ Q832), W619 (≠ Y833), H620 (≠ N834), H620 (≠ N834), T621 (≠ V835), T623 (≠ A837), F686 (= F899), N694 (= N907), Y710 (= Y923), K711 (= K924)
- binding nitrite ion: V615 (≠ I829), F686 (= F899)
- binding iron/sulfur cluster: C10 (= C257), C13 (= C260), T15 (≠ V262), C17 (= C264), L43 (≠ S291), C44 (= C292), P179 (= P427), V180 (= V428)
2jiqA A new catalytic mechanism of periplasmic nitrate reductase from desulfovibrio desulfuricans atcc 27774 from crystallographic and epr data and based on detailed analysis of the sixth ligand (see paper)
28% identity, 71% coverage: 248:932/971 of query aligns to 1:719/720 of 2jiqA
- active site: K46 (= K294), S106 (= S354), C137 (= C385), M138 (≠ H386), A177 (= A425), M305 (≠ L550), T341 (≠ R586), G342 (= G587), Q343 (= Q588)
- binding 2-amino-5,6-dimercapto-7-methyl-3,7,8a,9-tetrahydro-8-oxa-1,3,9,10-tetraaza-anthracen-4-one guanosine dinucleotide: R11 (≠ A258), Q108 (≠ R356), C137 (= C385), G171 (= G419), S172 (≠ A420), E176 (≠ D424), A177 (= A425), D201 (= D447), P202 (= P448), R203 (= R449), P219 (= P469), D222 (≠ N472), C304 (≠ G549), M305 (≠ L550), G306 (= G551), Q309 (≠ E554), R310 (≠ H555), G342 (= G587), Q343 (= Q588), Q343 (= Q588), E413 (≠ G654), T414 (≠ E655), N415 (≠ D656), T419 (≠ S660), I440 (≠ Q680), E441 (≠ D681), F443 (= F683), P458 (≠ G697), F460 (≠ S699), S612 (≠ T826), M613 (≠ G827), R614 (= R828), R614 (= R828), I616 (≠ L830), H618 (≠ Q832), W619 (≠ Y833), H620 (≠ N834), H620 (≠ N834), T621 (≠ V835), T623 (≠ A837), F686 (= F899), N694 (= N907), Y710 (= Y923), K711 (= K924)
- binding nitrate ion: M251 (vs. gap), K583 (vs. gap), V589 (≠ Q803), W591 (≠ A805), R593 (≠ T807), V704 (≠ A917)
- binding iron/sulfur cluster: C10 (= C257), C13 (= C260), T15 (≠ V262), C17 (= C264), L43 (≠ S291), C44 (= C292), V180 (= V428)
P81186 Periplasmic nitrate reductase; EC 1.9.6.1 from Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949 / MB) (see 3 papers)
28% identity, 71% coverage: 248:932/971 of query aligns to 36:754/755 of P81186
Sites not aligning to the query:
- 1:32 signal peptide, Tat-type signal
7t30A Structure of electron bifurcating ni-fe hydrogenase complex hydabcsl in fmn/NAD(h) bound state (see paper)
27% identity, 73% coverage: 33:745/971 of query aligns to 4:641/666 of 7t30A
- binding fe2/s2 (inorganic) cluster: C36 (= C65), G45 (= G74), C47 (= C76), R48 (= R77), C50 (= C79), C64 (= C93)
- binding iron/sulfur cluster: F93 (≠ I122), H98 (≠ L127), F99 (≠ D128), C100 (= C129), C103 (= C132), Q105 (≠ A134), C109 (= C138), L141 (≠ F173), R147 (≠ K179), C148 (= C180), L150 (≠ V182), C151 (= C183), Q152 (≠ S184), C154 (= C186), C158 (= C190), C192 (= C223), V193 (= V224), N194 (≠ S225), C195 (= C226), G196 (= G227), A197 (= A228), C198 (= C229), C202 (= C233), P203 (= P234), T204 (= T235), G205 (≠ S236), T206 (= T237), I207 (≠ L238), C229 (= C257), C232 (= C260), G235 (= G263), C236 (= C264), L263 (≠ S291), C264 (= C292), V396 (= V428)
8oh5C Cryo-em structure of the electron bifurcating transhydrogenase stnabc complex from sporomusa ovata (state 2) (see paper)
29% identity, 64% coverage: 168:791/971 of query aligns to 601:1136/1172 of 8oh5C
- binding iron/sulfur cluster: C613 (= C180), V614 (≠ I181), L615 (≠ V182), C616 (= C183), G617 (≠ S184), C619 (= C186), C623 (= C190), I643 (≠ V210), C656 (= C223), I657 (≠ V224), S658 (= S225), C659 (= C226), G660 (= G227), C662 (= C229), C666 (= C233), G669 (≠ S236), A670 (≠ T237), C692 (= C257), Y694 (= Y259), C695 (= C260), C699 (= C264), C725 (= C292), R727 (≠ K294), G728 (= G295), V853 (= V428)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 199, 201, 202, 203, 222, 223, 229, 230, 235, 239, 264, 265, 285, 288, 332, 471, 477, 479
- binding fe2/s2 (inorganic) cluster: 36, 45, 47, 48, 50, 64
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: 330, 331, 332, 333, 353, 354, 355, 432, 433, 434, 477
- binding iron/sulfur cluster: 96, 98, 100, 102, 104, 108, 147, 149, 151, 155, 156, 164, 170, 480, 562, 563, 565, 567, 573
P33937 Periplasmic nitrate reductase; EC 1.9.6.1 from Escherichia coli (strain K12) (see 3 papers)
25% identity, 70% coverage: 257:933/971 of query aligns to 46:828/828 of P33937
- C46 (= C257) binding
- C49 (= C260) binding
- C53 (= C264) binding
- C81 (= C292) binding
- K83 (= K294) binding
- Q150 (≠ R356) binding
- N175 (≠ C381) binding
- C179 (= C385) binding
- 212:219 (vs. 418:425, 38% identical) binding
- STYQH 243:247 (≠ KTPHH 455:459) binding
- QSD 262:264 (≠ GTN 470:472) binding
- M372 (≠ L550) binding
- Q376 (≠ E554) binding
- N482 (≠ D656) binding
- SD 508:509 (≠ QD 680:681) binding
- K531 (= K703) binding
- D558 (vs. gap) binding
- 718:727 (vs. 826:835, 40% identical) binding
- N802 (= N907) binding
- K819 (= K924) binding
Sites not aligning to the query:
- 1:36 signal peptide, Tat-type signal
- 6 R→Q: Impairs interaction with NapD. Lack of nitrate reductase activity. Tat transport is blocked.
- 10 K→Q: Impairs interaction with NapD. Slight decrease in nitrate reductase activity. Minor defect in Tat transport.
- 17 A→L: Impairs interaction with NapD.; A→Q: Impairs interaction with NapD. Decrease in nitrate reductase activity. Defect in Tat transport.
2nyaA Crystal structure of the periplasmic nitrate reductase (nap) from escherichia coli (see paper)
25% identity, 70% coverage: 257:932/971 of query aligns to 10:791/791 of 2nyaA
- active site: N44 (≠ S291), C45 (= C292), K47 (= K294), C143 (= C385), M144 (≠ H386), M183 (≠ A425), M336 (≠ L550), T372 (≠ R586), G373 (= G587), Q374 (= Q588)
- binding 2-amino-5,6-dimercapto-7-methyl-3,7,8a,9-tetrahydro-8-oxa-1,3,9,10-tetraaza-anthracen-4-one guanosine dinucleotide: R11 (≠ A258), K47 (= K294), Q114 (≠ R356), N139 (≠ C381), C143 (= C385), W176 (≠ I418), G177 (= G419), M183 (≠ A425), S207 (≠ K455), T208 (= T456), Y209 (≠ P457), F223 (≠ L467), D228 (≠ N472), T335 (≠ G549), M336 (≠ L550), M336 (≠ L550), G337 (= G551), F338 (≠ V552), Q340 (≠ E554), G373 (= G587), Q374 (= Q588), Q374 (= Q588), C444 (≠ G654), T445 (≠ E655), N446 (≠ D656), A450 (≠ S660), S472 (≠ Q680), D473 (= D681), P474 (≠ I682), T489 (≠ G697), A490 (≠ S698), M491 (≠ S699), K495 (= K703), D522 (vs. gap), T682 (= T826), G683 (= G827), R684 (= R828), R684 (= R828), L686 (= L830), H688 (≠ Q832), W689 (≠ Y833), H690 (≠ N834), H690 (≠ N834), T691 (≠ V835), S693 (≠ A837), F758 (= F899), N766 (= N907), F782 (≠ Y923), K783 (= K924), K784 (≠ V925)
- binding iron/sulfur cluster: C10 (= C257), C13 (= C260), C17 (= C264), C45 (= C292), I186 (≠ V428)
8e9hG Mycobacterial respiratory complex i, fully-inserted quinone (see paper)
31% identity, 43% coverage: 32:448/971 of query aligns to 4:413/782 of 8e9hG
- binding fe2/s2 (inorganic) cluster: R35 (≠ K63), C37 (= C65), D38 (≠ A66), G46 (= G74), C48 (= C76), R49 (= R77), C51 (= C79), A63 (= A91), C65 (= C93)
- binding guanosine-5'-triphosphate: R320 (= R356)
- binding iron/sulfur cluster: H99 (= H125), D102 (= D128), C103 (= C129), C106 (= C132), G109 (≠ N135), C112 (= C138), Q115 (= Q141), C152 (= C180), V153 (≠ I181), L154 (≠ V182), C155 (= C183), A156 (≠ S184), R157 (= R185), C158 (= C186), C202 (= C233), P203 (= P234), V204 (≠ T235), A206 (≠ T237), L207 (= L238), C228 (= C257), C231 (= C260), S233 (≠ V262), C235 (= C264), N262 (≠ S291), C263 (= C292), G266 (= G295), P391 (= P427), I392 (≠ V428)
Sites not aligning to the query:
- binding guanosine-5'-triphosphate: 486, 487, 554, 556, 559, 579, 580, 582, 627, 689, 695, 696, 697
P39185 Periplasmic nitrate reductase; EC 1.9.6.1 from Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337) (Ralstonia eutropha) (see 2 papers)
25% identity, 70% coverage: 257:933/971 of query aligns to 48:831/831 of P39185
- C48 (= C257) binding
- C51 (= C260) binding
- C55 (= C264) binding
- C83 (= C292) binding
- K85 (= K294) binding
- Q152 (≠ R356) binding
- N177 (≠ C381) binding
- C181 (= C385) binding
- 214:221 (vs. 418:425, 25% identical) binding
- STFTH 245:249 (≠ KTPHH 455:459) binding
- QTD 264:266 (≠ GTN 470:472) binding
- M375 (≠ L550) binding
- Q379 (≠ E554) binding
- N485 (≠ D656) binding
- SD 511:512 (≠ QD 680:681) binding
- K534 (= K703) binding
- D561 (vs. gap) binding
- 721:730 (vs. 826:835, 40% identical) binding
- N805 (= N907) binding
- K822 (= K924) binding
Sites not aligning to the query:
- 1:29 signal peptide, Tat-type signal
3ml1A Crystal structure of the periplasmic nitrate reductase from cupriavidus necator (see paper)
25% identity, 70% coverage: 257:933/971 of query aligns to 16:799/799 of 3ml1A
- active site: N50 (≠ S291), C51 (= C292), K53 (= K294), G119 (≠ S355), W121 (≠ C357), C149 (= C385), M150 (≠ H386), M343 (≠ L550), T379 (≠ R586), G380 (= G587), Q381 (= Q588)
- binding heme c: L49 (≠ H290), Y55 (≠ R296)
- binding 2-amino-5,6-dimercapto-7-methyl-3,7,8a,9-tetrahydro-8-oxa-1,3,9,10-tetraaza-anthracen-4-one guanosine dinucleotide: R17 (≠ A258), K53 (= K294), Q120 (≠ R356), N145 (≠ C381), H148 (≠ V384), C149 (= C385), W182 (≠ I418), G183 (= G419), N185 (= N421), M189 (≠ A425), S213 (≠ K455), T214 (= T456), F215 (≠ P457), H217 (= H459), F229 (≠ L467), D234 (≠ N472), T342 (≠ G549), M343 (≠ L550), G344 (= G551), F345 (≠ V552), Q347 (≠ E554), G380 (= G587), Q381 (= Q588), Q381 (= Q588), V451 (≠ G654), N452 (≠ E655), N453 (≠ D656), A457 (≠ S660), S479 (≠ Q680), D480 (= D681), S496 (≠ G697), M498 (≠ S699), K502 (= K703), D529 (vs. gap), T689 (= T826), G690 (= G827), R691 (= R828), R691 (= R828), L693 (= L830), H695 (≠ Q832), W696 (≠ Y833), W696 (≠ Y833), H697 (≠ N834), H697 (≠ N834), S698 (≠ V835), S700 (≠ A837), W765 (≠ F899), N773 (= N907), F789 (≠ Y923), K790 (= K924)
- binding iron/sulfur cluster: C16 (= C257), C19 (= C260), T21 (≠ V262), C23 (= C264), N50 (≠ S291), C51 (= C292)
8a6tA Cryo-em structure of the electron bifurcating fe-fe hydrogenase hydabc complex from thermoanaerobacter kivui in the reduced state (see paper)
41% identity, 22% coverage: 31:246/971 of query aligns to 2:212/571 of 8a6tA
- binding fe2/s2 (inorganic) cluster: C36 (= C65), D37 (≠ A66), C47 (= C76), R48 (= R77), C50 (= C79), C63 (= C93)
- binding iron/sulfur cluster: H95 (= H125), C99 (= C129), C102 (= C132), C108 (= C138), C146 (= C180), C149 (= C183), G150 (≠ S184), K151 (≠ R185), C152 (= C186), C156 (= C190), C189 (= C223), C192 (= C226), C195 (= C229), C199 (= C233), G202 (≠ S236)
Sites not aligning to the query:
- binding 2 iron/2 sulfur/5 carbonyl/2 water inorganic cluster: 229, 230, 231, 298, 323, 352, 353, 357, 412, 500
- binding iron/sulfur cluster: 299, 354, 496, 500
3i9vC Crystal structure of the hydrophilic domain of respiratory complex i from thermus thermophilus, oxidized, 2 mol/asu (see paper)
26% identity, 70% coverage: 32:714/971 of query aligns to 1:598/754 of 3i9vC
- active site: A270 (≠ K294), A353 (≠ C385), A354 (≠ H386), A486 (≠ L550), P514 (≠ G587), A515 (≠ Q588)
- binding calcium ion: D142 (= D163), H145 (≠ T166)
- binding fe2/s2 (inorganic) cluster: C34 (= C65), S35 (≠ A66), G43 (= G74), A44 (≠ S75), C45 (= C76), R46 (= R77), C48 (= C79), C66 (= C93)
- binding manganese (ii) ion: L251 (≠ V275), D279 (≠ T303)
- binding iron/sulfur cluster: H98 (= H125), D101 (= D128), C102 (= C129), C105 (= C132), K107 (≠ A134), C111 (= C138), L113 (= L140), Q114 (= Q141), C158 (= C180), I159 (= I181), C161 (= C183), C164 (= C186), F179 (≠ I201), I188 (≠ V210), C207 (= C233), P208 (= P234), V209 (≠ T235), A211 (≠ T237), C233 (= C257), L235 (≠ Y259), C236 (= C260), V238 (= V262), G239 (= G263), C240 (= C264), C268 (= C292), G271 (= G295), P384 (= P427)
Query Sequence
>WP_086509118.1 NCBI__GCF_002151265.1:WP_086509118.1
MLNYYDPKQTPAPQHFLPERDYGTPARLSETLVSLEIDGVAITVPEGTSVLRAAALADIN
IPKLCASDNLEAFGSCRLCAVQIEGRRGLPASCTTPVAAGMKVTTQNARLAKLRRNVMEL
YISDHPLDCLTCPANGDCELQDMAGVVGLREVRYGFDGENHLDAETDDSNPYFSFDPSKC
IVCSRCVRACEEVQGTFALTIEGRGFESKVAAGQSEAFMDSECVSCGACVQACPTSTLME
KSVIEQGQPEHSVVTTCAYCGVGCSFKAEMQGDRVVRMVPYKGGDANHGHSCVKGRFAFG
YATHPDRLKTPMIRESIDQPWREVGWEEAIAFAAQRLKAIQAKYGRESIGGITSSRCTNE
ETYLVQKLVRAAFRNNNTDTCARVCHSPTGYGLKTTLGESAGTQTFDSVMQADVIVVIGA
NPTDAHPVFASQMRRRLRQGAELIVVDPRRIDLLKTPHHRGAQHLALRPGTNVAMINALA
HVVMSEGLEDREFIAKRCDAAGYQAWREFILDPRHAPENVEAITGVPAEQVRRAARTYAQ
APNGAIYYGLGVTEHSQGSSMVMGIANLAMATGNIGREGVGVNPLRGQNNVQGSCDMGSF
PHELPGYQHVGDPAVRERFEAAWGVPIDDEPGLRIPNMFDAAVAGEFKALYVQGEDIAQS
DPNTQHVEQALRSLECLIVQDIFLNETAKFAHVLLPGSSFLEKDGTFTNAERRINRVRKV
MPPLAGKQDWEVTVDLANALGYPMHYDHPSQIMDEIAGLTPSFTGVSYARLDELGSIQWP
CNEAYPKGMPTMHVEDFPIGLGQFAITDYVASDELSNRRFPLLLTTGRILSQYNVGAQTR
RTHNQAWHDEDVLELHPADAELRGVRDGDWVGITSRAGQTVLRARISDRMPPGVVYTTFH
HPGSGANVITTDSSDWATNCPEYKVTAVQVEKVSQPSAWQQQFQTFDRLQLELLRGGNKD
EAGQALSGARE
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory