Comparing WP_086509147.1 NCBI__GCF_002151265.1:WP_086509147.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 17 hits to proteins with known functional sites (download)
4z9nB Abc transporter / periplasmic binding protein from brucella ovis with glutathione bound
60% identity, 93% coverage: 26:342/342 of query aligns to 4:324/324 of 4z9nB
1xt8B Crystal structure of cysteine-binding protein from campylobacter jejuni at 2.0 a resolution (see paper)
27% identity, 63% coverage: 26:239/342 of query aligns to 3:208/251 of 1xt8B
2v25A Structure of the campylobacter jejuni antigen peb1a, an aspartate and glutamate receptor with bound aspartate (see paper)
25% identity, 63% coverage: 30:244/342 of query aligns to 3:211/231 of 2v25A
4zv1A An ancestral arginine-binding protein bound to arginine (see paper)
27% identity, 63% coverage: 36:251/342 of query aligns to 3:211/226 of 4zv1A
4zv2A An ancestral arginine-binding protein bound to glutamine (see paper)
27% identity, 63% coverage: 36:251/342 of query aligns to 3:209/225 of 4zv2A
2yjpA Crystal structure of the solute receptors for l-cysteine of neisseria gonorrhoeae (see paper)
24% identity, 66% coverage: 27:251/342 of query aligns to 1:217/247 of 2yjpA
5t0wA Crystal structure of the ancestral amino acid-binding protein anccdt- 1, a precursor of cyclohexadienyl dehydratase
25% identity, 63% coverage: 28:244/342 of query aligns to 1:207/229 of 5t0wA
6h2tA Glnh bound to glu, mycobacterium tuberculosis (see paper)
35% identity, 36% coverage: 36:159/342 of query aligns to 51:173/288 of 6h2tA
Sites not aligning to the query:
6h20A Glnh bound to asn, mycobacterium tuberculosis (see paper)
35% identity, 36% coverage: 36:159/342 of query aligns to 50:172/287 of 6h20A
Sites not aligning to the query:
6h1uA Glnh bound to asp, mycobacterium tuberculosis (see paper)
35% identity, 36% coverage: 36:159/342 of query aligns to 50:172/287 of 6h1uA
Sites not aligning to the query:
2ia4B Crystal structure of novel amino acid binding protein from shigella flexneri
25% identity, 65% coverage: 22:244/342 of query aligns to 1:225/278 of 2ia4B
2vhaA Debp (see paper)
25% identity, 64% coverage: 25:244/342 of query aligns to 3:224/276 of 2vhaA
8ovoA X-ray structure of the sf-iglusnfr-s72a in complex with l-aspartate
24% identity, 64% coverage: 25:244/342 of query aligns to 1:222/503 of 8ovoA
6svfA Crystal structure of the p235gk mutant of argbp from t. Maritima (see paper)
24% identity, 61% coverage: 36:244/342 of query aligns to 9:206/229 of 6svfA
3k4uE Crystal structure of putative binding component of abc transporter from wolinella succinogenes dsm 1740 complexed with lysine
23% identity, 61% coverage: 36:242/342 of query aligns to 3:203/234 of 3k4uE
1iitA Glur0 ligand binding core complex with l-serine (see paper)
27% identity, 52% coverage: 57:235/342 of query aligns to 20:191/221 of 1iitA
1ii5A Crystal structure of the glur0 ligand binding core complex with l- glutamate (see paper)
27% identity, 52% coverage: 57:235/342 of query aligns to 20:191/221 of 1ii5A
Sites not aligning to the query:
>WP_086509147.1 NCBI__GCF_002151265.1:WP_086509147.1
MRDNKNKWLLVTSAAVLALGTASLASANTLQNTIQRGAVQCGVSDGLPGFSAPDDQGEWQ
GLDVDVCRAVAAAVFGDADAVRYISLNAVERFTALQSGEVDVLSRNTTWTTTRDTTLGLN
FTGVTFYDGIGFMINRDLGVSSALDLDGAAICVQSGTTTELNVADYFRANGMEFDPIVFD
TSEQTVGGYEAGRCDVLTSDTSQLAALRIQLSDPDQSVILPEIISKEPLGPVVRQGDDQW
FNIVKWSLFAMLNAEEMGITQENVDEMRNSDDPDIARLLGQDGNYGEGMGLDANWAYNII
SQVGNYGESFERNVGMGSPLQIERGINALWTNGGIQYAPPIR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory