Comparing WP_086509383.1 NCBI__GCF_002151265.1:WP_086509383.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3lkiB Crystal structure of fructokinase with bound atp from xylella fastidiosa
44% identity, 99% coverage: 3:326/326 of query aligns to 4:320/322 of 3lkiB
5eynA Crystal structure of fructokinase from vibrio cholerae o395 in fructose, adp, beryllium trifluoride and calcium ion bound form
35% identity, 92% coverage: 21:319/326 of query aligns to 13:301/306 of 5eynA
Sites not aligning to the query:
5yggA Crystal structure of fructokinase double-mutant (t261c-h108c) from vibrio cholerae o395 in fructose, adp and potassium ion bound form (see paper)
35% identity, 92% coverage: 21:319/326 of query aligns to 17:305/310 of 5yggA
Sites not aligning to the query:
Q8ZKR2 Aminoimidazole riboside kinase; AIRs kinase; EC 2.7.1.223 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
33% identity, 96% coverage: 1:314/326 of query aligns to 4:298/319 of Q8ZKR2
3gbuA Crystal structure of an uncharacterized sugar kinase ph1459 from pyrococcus horikoshii in complex with atp
32% identity, 81% coverage: 4:267/326 of query aligns to 2:253/302 of 3gbuA
Sites not aligning to the query:
3ih0A Crystal structure of an uncharacterized sugar kinase ph1459 from pyrococcus horikoshii in complex with amp-pnp
32% identity, 81% coverage: 4:267/326 of query aligns to 3:254/304 of 3ih0A
Sites not aligning to the query:
1tz6A Crystal structure of aminoimidazole riboside kinase from salmonella enterica complexed with aminoimidazole riboside and atp analog (see paper)
33% identity, 90% coverage: 21:314/326 of query aligns to 12:287/297 of 1tz6A
Sites not aligning to the query:
1tz3A Crystal structure of aminoimidazole riboside kinase complexed with aminoimidazole riboside (see paper)
33% identity, 90% coverage: 21:314/326 of query aligns to 12:287/299 of 1tz3A
Sites not aligning to the query:
4wjmA Crystal structure of fructokinase from brucella abortus 2308 with bound amppnp
30% identity, 94% coverage: 4:309/326 of query aligns to 8:304/312 of 4wjmA
Q9M394 Fructokinase-like 1, chloroplastic; PEP-associated protein 6; pfkB-type carbohydrate kinase family protein 2 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
26% identity, 95% coverage: 15:325/326 of query aligns to 129:464/471 of Q9M394
Sites not aligning to the query:
3iq0B Crystal structure of a putative ribokinase ii in complex with atp and mg+2 from e.Coli
29% identity, 94% coverage: 3:308/326 of query aligns to 3:290/308 of 3iq0B
Q53W83 2-dehydro-3-deoxygluconokinase; 2-keto-3-deoxygluconokinase; 3-deoxy-2-oxo-D-gluconate kinase; KDG kinase; EC 2.7.1.45 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see paper)
31% identity, 90% coverage: 1:295/326 of query aligns to 1:306/309 of Q53W83
8cqxA Ribokinase from t.Sp mutant a92g
33% identity, 90% coverage: 30:322/326 of query aligns to 31:297/300 of 8cqxA
1v1aA 2-keto-3-deoxygluconate kinase from thermus thermophilus with bound 2- keto-3-deoxygluconate and adp (see paper)
32% identity, 82% coverage: 1:267/326 of query aligns to 1:259/301 of 1v1aA
Sites not aligning to the query:
1v1bA 2-keto-3-deoxygluconate kinase from thermus thermophilus with bound atp (see paper)
32% identity, 82% coverage: 1:267/326 of query aligns to 1:259/300 of 1v1bA
Sites not aligning to the query:
F4I0K2 Fructokinase-like 2, chloroplastic; pfkB-type carbohydrate kinase family protein 1 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
23% identity, 88% coverage: 15:300/326 of query aligns to 232:530/614 of F4I0K2
Sites not aligning to the query:
7fcaD Pfkb(mycobacterium marinum) (see paper)
31% identity, 94% coverage: 5:309/326 of query aligns to 5:282/282 of 7fcaD
6znxC Ribokinase from thermus species
32% identity, 90% coverage: 30:322/326 of query aligns to 18:262/265 of 6znxC
7agkA Crystal structure of e. Coli sf kinase (yihv) in complex with product sulfofructose phosphate (sfp) (see paper)
28% identity, 88% coverage: 28:315/326 of query aligns to 31:286/298 of 7agkA
Sites not aligning to the query:
P32143 Sulfofructose kinase; SF kinase; EC 2.7.1.184 from Escherichia coli (strain K12) (see paper)
28% identity, 88% coverage: 28:315/326 of query aligns to 31:286/298 of P32143
Sites not aligning to the query:
>WP_086509383.1 NCBI__GCF_002151265.1:WP_086509383.1
MLSVIAFGEALVDMLSSRLGDLAGDAPKTFTPYAGGAPANVAVACARLGVPSRFLGMLGE
DHFGDFLAGELAAHGVDTSGVVRTREARTALAFVSRDASGERTFDFYRPPAADLLYRLEH
LPPGVFAEPAIVHFCSNSLTEPEIADTTLAMADMASRAGCLVSVDANLRHNLWAGGSADI
TLVTQLIDRAGLVKLSTDELDYLRADHPAEAWLAERLAAGVRLLVITDGPGEVRAIGVGR
ELRHAPPRVEAVDTTAGGDAFIGGLLAELADYLGATAGDGDWHKDDDFLRRALRTAANCG
AHAVTRPGAYAALPNRGDLARLRGES
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory