SitesBLAST
Comparing WP_086509457.1 NCBI__GCF_002151265.1:WP_086509457.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4bmsF Short chain alcohol dehydrogenase from ralstonia sp. Dsm 6428 in complex with NADPH
37% identity, 98% coverage: 5:251/251 of query aligns to 1:247/249 of 4bmsF
- active site: S137 (= S136), H147 (≠ V146), Y150 (= Y149), K154 (= K153), Q195 (≠ G199)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G17), N15 (≠ G19), S16 (= S20), I18 (= I22), R38 (= R42), R39 (= R43), A59 (= A62), D60 (= D63), V61 (= V64), N87 (= N86), S88 (≠ A87), G89 (= G88), V110 (= V109), S137 (= S136), Y150 (= Y149), K154 (= K153), G181 (= G180), I183 (≠ T182), T185 (= T184), I187 (≠ L186)
6ihhA Crystal structure of rasadh f12 from ralstonia.Sp in complex with NADPH and a6o
37% identity, 98% coverage: 5:251/251 of query aligns to 1:247/249 of 6ihhA
- binding (2R,3S)-2-ethyl-2-[(2E)-2-(6-methoxy-3,4-dihydro-2H-naphthalen-1-ylidene)ethyl]-3-oxidanyl-cyclopentan-1-one: S137 (= S136), H147 (≠ V146), Y150 (= Y149), L188 (= L187), L246 (≠ E250)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G17), N15 (≠ G19), S16 (= S20), G17 (= G21), I18 (= I22), R38 (= R42), R39 (= R43), D60 (= D63), V61 (= V64), N87 (= N86), S88 (≠ A87), G89 (= G88), V110 (= V109), T135 (≠ V134), S137 (= S136), Y150 (= Y149), K154 (= K153), P180 (= P179), G181 (= G180), A182 (≠ F181), I183 (≠ T182), T185 (= T184), S187 (≠ L186)
2rh4A Actinorhodin ketoreductase, actkr, with NADPH and inhibitor emodin (see paper)
37% identity, 94% coverage: 14:249/251 of query aligns to 6:253/257 of 2rh4A
- active site: G13 (= G21), N110 (= N110), S140 (= S136), Y153 (= Y149), K157 (= K153), Y198 (≠ V195)
- binding 3-methyl-1,6,8-trihydroxyanthraquinone: T141 (= T137), Q145 (≠ K141), V147 (≠ Y143), Y153 (= Y149), F185 (= F181)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G9 (= G17), T11 (≠ G19), S12 (= S20), G13 (= G21), I14 (= I22), A33 (≠ G41), R34 (= R42), G35 (≠ R43), C58 (= C59), D59 (≠ E60), V60 (≠ I61), N86 (= N86), G88 (= G88), S140 (= S136), Y153 (= Y149), K157 (= K153), P183 (= P179), G184 (= G180), V186 (≠ T182), T188 (= T184), M190 (≠ L187)
Sites not aligning to the query:
1xr3A Actinorhodin polyketide ketoreductase with NADP and the inhibitor isoniazid bound (see paper)
37% identity, 94% coverage: 14:249/251 of query aligns to 5:252/256 of 1xr3A
- active site: G12 (= G21), N109 (= N110), S139 (= S136), Y152 (= Y149), K156 (= K153), Y197 (≠ V195)
- binding 4-(diazenylcarbonyl)pyridine: T140 (= T137), G141 (≠ A138), V146 (≠ Y143)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G17), T10 (≠ G19), S11 (= S20), G12 (= G21), I13 (= I22), A32 (≠ G41), R33 (= R42), G34 (≠ R43), C57 (= C59), D58 (≠ E60), V59 (≠ I61), N85 (= N86), A86 (= A87), G87 (= G88), S139 (= S136), Y152 (= Y149), K156 (= K153), G183 (= G180), V185 (≠ T182), T187 (= T184), P188 (= P185)
P16544 Putative ketoacyl reductase; EC 1.3.1.- from Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) (see 2 papers)
37% identity, 94% coverage: 14:249/251 of query aligns to 10:257/261 of P16544
- 11:39 (vs. 15:43, 34% identical) binding
- D63 (≠ E60) binding
- K161 (= K153) binding
1w4zA Structure of actinorhodin polyketide (actiii) reductase (see paper)
37% identity, 94% coverage: 14:249/251 of query aligns to 8:255/259 of 1w4zA
- active site: G15 (= G21), N112 (= N110), S142 (= S136), Y155 (= Y149), K159 (= K153), Y200 (≠ V195)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G11 (= G17), T13 (≠ G19), S14 (= S20), G15 (= G21), I16 (= I22), R36 (= R42), G37 (≠ R43), D61 (≠ E60), V62 (≠ I61), N88 (= N86), G90 (= G88), S142 (= S136), Y155 (= Y149), K159 (= K153), P185 (= P179), G186 (= G180), V188 (≠ T182), T190 (= T184)
2rh4B Actinorhodin ketoreductase, actkr, with NADPH and inhibitor emodin (see paper)
37% identity, 94% coverage: 14:249/251 of query aligns to 17:264/268 of 2rh4B
- active site: G24 (= G21), N121 (= N110), S151 (= S136), Y164 (= Y149), K168 (= K153), Y209 (≠ V195)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G20 (= G17), T22 (≠ G19), S23 (= S20), I25 (= I22), A44 (≠ G41), R45 (= R42), G46 (≠ R43), C69 (= C59), D70 (≠ E60), V71 (≠ I61), N97 (= N86), S151 (= S136), Y164 (= Y149), K168 (= K153), G195 (= G180), V197 (≠ T182), T199 (= T184), M201 (≠ L187)
5yssB Crystal structure of aminocaproic acid cyclase in complex with NAD (+) (see paper)
35% identity, 97% coverage: 7:249/251 of query aligns to 1:251/255 of 5yssB
- binding nicotinamide-adenine-dinucleotide: G11 (= G17), T13 (≠ G19), S14 (= S20), G15 (= G21), I16 (= I22), G35 (= G41), F36 (≠ R42), L60 (≠ I61), N86 (= N86), G88 (= G88), I89 (≠ A89), A137 (= A135), Y151 (= Y149), K155 (= K153), P181 (= P179), G182 (= G180), V184 (≠ T182), T186 (= T184)
5b4tA Crystal structure of d-3-hydroxybutyrate dehydrogenase from alcaligenes faecalis complexed with NAD+ and a substrate d-3- hydroxybutyrate (see paper)
35% identity, 97% coverage: 8:251/251 of query aligns to 2:258/260 of 5b4tA
- active site: G15 (= G21), N114 (= N110), S142 (= S136), Y155 (= Y149), K159 (= K153), I200 (= I194)
- binding (3R)-3-hydroxybutanoic acid: Q94 (≠ A90), S142 (= S136), H144 (≠ A138), K152 (≠ V146), Y155 (= Y149), W187 (≠ F181), Q196 (≠ S190)
- binding nicotinamide-adenine-dinucleotide: G11 (= G17), T13 (≠ G19), G15 (= G21), I16 (= I22), F36 (vs. gap), D63 (≠ E60), L64 (≠ I61), N90 (= N86), G92 (= G88), L113 (≠ V109), I140 (≠ V134), Y155 (= Y149), K159 (= K153), P185 (= P179), G186 (= G180), W187 (≠ F181), V188 (≠ T182), T190 (= T184), L192 (= L186), V193 (≠ L187)
3w8dA Crystal structure of d-3-hydroxybutyrate dehydrogenase from alcaligenes faecalis complexed with NAD+ and an inhibitor methylmalonate
35% identity, 97% coverage: 8:251/251 of query aligns to 2:258/260 of 3w8dA
- active site: G15 (= G21), N114 (= N110), S142 (= S136), Y155 (= Y149), K159 (= K153), I200 (= I194)
- binding methylmalonic acid: Q94 (≠ A90), S142 (= S136), H144 (≠ A138), K152 (≠ V146), Y155 (= Y149), W187 (≠ F181), Q196 (≠ S190), W257 (≠ E250)
- binding nicotinamide-adenine-dinucleotide: G11 (= G17), T13 (≠ G19), S14 (= S20), G15 (= G21), I16 (= I22), F36 (vs. gap), A62 (≠ C59), D63 (≠ E60), L64 (≠ I61), N90 (= N86), A91 (= A87), G92 (= G88), L113 (≠ V109), S142 (= S136), Y155 (= Y149), K159 (= K153), P185 (= P179), G186 (= G180), W187 (≠ F181), V188 (≠ T182), T190 (= T184), L192 (= L186), V193 (≠ L187)
3vdrA Crystal structure of d-3-hydroxybutyrate dehydrogenase, prepared in the presence of the substrate d-3-hydroxybutyrate and NAD(+) (see paper)
35% identity, 97% coverage: 8:251/251 of query aligns to 2:258/260 of 3vdrA
- active site: G15 (= G21), N114 (= N110), S142 (= S136), Y155 (= Y149), K159 (= K153), I200 (= I194)
- binding (3R)-3-hydroxybutanoic acid: Q94 (≠ A90), H144 (≠ A138), K152 (≠ V146), Y155 (= Y149), W187 (≠ F181), Q196 (≠ S190), W257 (≠ E250)
- binding acetoacetic acid: Q94 (≠ A90), H144 (≠ A138), K152 (≠ V146), Y155 (= Y149), W187 (≠ F181), Q196 (≠ S190), W257 (≠ E250)
- binding nicotinamide-adenine-dinucleotide: G11 (= G17), T13 (≠ G19), I16 (= I22), F36 (vs. gap), D63 (≠ E60), L64 (≠ I61), N90 (= N86), A91 (= A87), G92 (= G88), L113 (≠ V109), K159 (= K153), G186 (= G180), V188 (≠ T182), T190 (= T184), L192 (= L186), V193 (≠ L187)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G11 (= G17), T13 (≠ G19), I16 (= I22), F36 (vs. gap), D63 (≠ E60), L64 (≠ I61), N90 (= N86), A91 (= A87), G92 (= G88), L113 (≠ V109), S142 (= S136), Y155 (= Y149), K159 (= K153), G186 (= G180), V188 (≠ T182), T190 (= T184), L192 (= L186), V193 (≠ L187)
3vdqA Crystal structure of alcaligenes faecalis d-3-hydroxybutyrate dehydrogenase in complex with NAD(+) and acetate (see paper)
35% identity, 97% coverage: 8:251/251 of query aligns to 2:258/260 of 3vdqA
- active site: G15 (= G21), N114 (= N110), S142 (= S136), Y155 (= Y149), K159 (= K153), I200 (= I194)
- binding acetate ion: Q94 (≠ A90), H144 (≠ A138), K152 (≠ V146), W187 (≠ F181), L192 (= L186), Q196 (≠ S190)
- binding nicotinamide-adenine-dinucleotide: G11 (= G17), S14 (= S20), I16 (= I22), F36 (vs. gap), D63 (≠ E60), L64 (≠ I61), N90 (= N86), A91 (= A87), G92 (= G88), L113 (≠ V109), I140 (≠ V134), S142 (= S136), Y155 (= Y149), K159 (= K153), P185 (= P179), G186 (= G180), W187 (≠ F181), V188 (≠ T182), T190 (= T184), L192 (= L186), V193 (≠ L187)
6zzsD Crystal structure of (r)-3-hydroxybutyrate dehydrogenase from acinetobacter baumannii complexed with NAD+ and 3-oxovalerate (see paper)
35% identity, 98% coverage: 5:251/251 of query aligns to 1:259/261 of 6zzsD
- active site: G18 (= G21), S143 (= S136), Y156 (= Y149)
- binding nicotinamide-adenine-dinucleotide: G14 (= G17), S17 (= S20), I19 (= I22), D38 (≠ G41), M39 (≠ R42), D64 (≠ E60), V65 (≠ I61), N91 (= N86), A92 (= A87), G93 (= G88), M141 (≠ V134), A142 (= A135), S143 (= S136), Y156 (= Y149), K160 (= K153), P186 (= P179), G187 (= G180), V189 (≠ T182), T191 (= T184), L193 (= L186)
- binding 3-oxidanylidenepentanoic acid: Q95 (≠ A90), S143 (= S136), N145 (≠ A138), K153 (≠ V146), Y156 (= Y149), Q197 (≠ S190)
6zzqA Crystal structure of (r)-3-hydroxybutyrate dehydrogenase from acinetobacter baumannii complexed with NAD+ and acetoacetate (see paper)
35% identity, 97% coverage: 8:251/251 of query aligns to 4:258/260 of 6zzqA
- active site: G17 (= G21), S142 (= S136), Y155 (= Y149)
- binding acetoacetic acid: Q94 (≠ A90), S142 (= S136), K152 (≠ V146), Y155 (= Y149), Q196 (≠ S190)
- binding nicotinamide-adenine-dinucleotide: G13 (= G17), S16 (= S20), G17 (= G21), I18 (= I22), D37 (≠ G41), M38 (≠ R42), D63 (≠ E60), V64 (≠ I61), N90 (= N86), A91 (= A87), G92 (= G88), M140 (≠ V134), A141 (= A135), S142 (= S136), Y155 (= Y149), K159 (= K153), Y187 (≠ F181), V188 (≠ T182), T190 (= T184)
2q2qD Structure of d-3-hydroxybutyrate dehydrogenase from pseudomonas putida (see paper)
36% identity, 96% coverage: 8:249/251 of query aligns to 2:251/255 of 2q2qD
- active site: G15 (= G21), S138 (= S136), Y151 (= Y149), K155 (= K153), R196 (≠ I194)
- binding nicotinamide-adenine-dinucleotide: G11 (= G17), T13 (≠ G19), S14 (= S20), G15 (= G21), I16 (= I22), F36 (≠ R42), D59 (≠ E60), L60 (≠ I61), N86 (= N86), G88 (= G88), L109 (≠ V109), I136 (≠ V134), S138 (= S136), Y151 (= Y149), K155 (= K153), P181 (= P179), G182 (= G180), W183 (≠ F181), V184 (≠ T182), T186 (= T184), L188 (= L186), V189 (≠ L187)
4nbuB Crystal structure of fabg from bacillus sp (see paper)
31% identity, 98% coverage: 5:249/251 of query aligns to 2:241/244 of 4nbuB
- active site: G18 (= G21), N111 (= N110), S139 (= S136), Q149 (≠ V146), Y152 (= Y149), K156 (= K153)
- binding acetoacetyl-coenzyme a: D93 (≠ S92), K98 (≠ R97), S139 (= S136), N146 (≠ Y143), V147 (≠ A144), Q149 (≠ V146), Y152 (= Y149), F184 (= F181), M189 (≠ L186), K200 (≠ H208)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G17), N17 (≠ S20), G18 (= G21), I19 (= I22), D38 (≠ G41), F39 (≠ R42), V59 (≠ A62), D60 (= D63), V61 (= V64), N87 (= N86), A88 (= A87), G89 (= G88), I90 (≠ A89), T137 (≠ V134), S139 (= S136), Y152 (= Y149), K156 (= K153), P182 (= P179), F184 (= F181), T185 (= T182), T187 (= T184), M189 (≠ L186)
2ztlA Closed conformation of d-3-hydroxybutyrate dehydrogenase complexed with NAD+ and l-3-hydroxybutyrate (see paper)
33% identity, 97% coverage: 8:251/251 of query aligns to 2:258/260 of 2ztlA
- active site: G15 (= G21), N114 (= N110), S142 (= S136), Y155 (= Y149), K159 (= K153), L200 (≠ I194)
- binding (3s)-3-hydroxybutanoic acid: Q94 (≠ A90), S142 (= S136), H144 (≠ A138), K152 (≠ V146), Y155 (= Y149), Q196 (≠ S190)
- binding nicotinamide-adenine-dinucleotide: G11 (= G17), G15 (= G21), I16 (= I22), F36 (vs. gap), L64 (≠ V64), N90 (= N86), A91 (= A87), G92 (= G88), L113 (≠ V109), Y155 (= Y149), K159 (= K153), P185 (= P179), W187 (≠ F181), V188 (≠ T182), T190 (= T184), V193 (≠ L187)
1wmbA Crystal structure of NAD dependent d-3-hydroxybutylate dehydrogenase (see paper)
33% identity, 97% coverage: 8:251/251 of query aligns to 2:258/260 of 1wmbA
6zzpA Crystal structure of (r)-3-hydroxybutyrate dehydrogenase from psychrobacter arcticus complexed with NAD+ and 3-oxovalerate (see paper)
32% identity, 96% coverage: 8:249/251 of query aligns to 8:261/265 of 6zzpA
- binding nicotinamide-adenine-dinucleotide: G17 (= G17), S20 (= S20), G21 (= G21), I22 (= I22), D41 (≠ G41), I42 (vs. gap), M66 (≠ C59), D67 (= D63), V68 (= V64), N94 (= N86), A95 (= A87), G96 (= G88), M145 (≠ V134), S147 (= S136), Y160 (= Y149), K164 (= K153), P190 (= P179), F192 (= F181), V193 (≠ T182), T195 (= T184), L197 (= L186), V198 (≠ L187)
- binding 3-oxidanylidenepentanoic acid: Q98 (≠ A90), S147 (= S136), H149 (≠ A138), K157 (≠ V146), Y160 (= Y149), F192 (= F181), Q201 (≠ S190)
6zzoC Crystal structure of (r)-3-hydroxybutyrate dehydrogenase from psychrobacter arcticus complexed with NAD+ and acetoacetate (see paper)
32% identity, 96% coverage: 8:249/251 of query aligns to 8:261/265 of 6zzoC
- binding acetoacetic acid: Q98 (≠ A90), H149 (≠ A138), K157 (≠ V146), F192 (= F181), Q201 (≠ S190)
- binding nicotinamide-adenine-dinucleotide: G17 (= G17), S20 (= S20), G21 (= G21), I22 (= I22), D41 (≠ G41), I42 (vs. gap), M66 (≠ C59), D67 (= D63), V68 (= V64), N94 (= N86), A95 (= A87), G96 (= G88), M145 (≠ V134), Y160 (= Y149), K164 (= K153), P190 (= P179), F192 (= F181), V193 (≠ T182), T195 (= T184), L197 (= L186), V198 (≠ L187)
Query Sequence
>WP_086509457.1 NCBI__GCF_002151265.1:WP_086509457.1
MDVIMDRLIGKRVVITGGGSGIGADMALAFAEAGADVTIIGRRREPLETTACRHPAIACE
IADVTREADMVALFERLGEVDIVIANAGAAESAPLARTGLDQWQRMLDVNLTGVFLTLRE
GLKRVRDGGRLIAVASTAGLKGYAYVAPYCAAKHGVVGLVRALAQEVAERDITVNALCPG
FTETPLLEASVATIVAKTGQSPAQARAHLQSTNPSGRLIQPAEVTATALWLCGPHSGAIH
GQAISISGGET
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory