Comparing WP_086509475.1 NCBI__GCF_002151265.1:WP_086509475.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3n9tA Cryatal structure of hydroxyquinol 1,2-dioxygenase from pseudomonas putida dll-e4
38% identity, 82% coverage: 22:278/313 of query aligns to 8:263/286 of 3n9tA
1tmxA Crystal structure of hydroxyquinol 1,2-dioxygenase from nocardioides simplex 3e (see paper)
38% identity, 90% coverage: 21:301/313 of query aligns to 14:291/292 of 1tmxA
Q5PXQ6 Hydroxyquinol 1,2-dioxygenase; 1,2-HQD; EC 1.13.11.37 from Nocardioides simplex (Arthrobacter simplex) (see paper)
38% identity, 90% coverage: 21:301/313 of query aligns to 15:292/293 of Q5PXQ6
2azqA Crystal structure of catechol 1,2-dioxygenase from pseudomonas arvilla c-1 (see paper)
32% identity, 86% coverage: 37:304/313 of query aligns to 27:293/309 of 2azqA
5umhB Crystal structure of catechol 1,2-dioxygenase protein from burkholderia multivorans
33% identity, 76% coverage: 26:262/313 of query aligns to 13:254/310 of 5umhB
3i51A Crystal structure determination of catechol 1,2-dioxygenase from rhodococcus opacus 1cp in complex with 4,5-dichlorocatechol (see paper)
41% identity, 54% coverage: 112:280/313 of query aligns to 77:244/256 of 3i51A
Sites not aligning to the query:
3i4yA Crystal structure determination of catechol 1,2-dioxygenase from rhodococcus opacus 1cp in complex with 3,5-dichlorocatechol (see paper)
41% identity, 54% coverage: 112:280/313 of query aligns to 77:244/256 of 3i4yA
Sites not aligning to the query:
3i4vA Crystal structure determination of catechol 1,2-dioxygenase from rhodococcus opacus 1cp in complex with 3-chlorocatechol (see paper)
41% identity, 54% coverage: 112:280/313 of query aligns to 77:244/256 of 3i4vA
3hjsA Crystal structure of catechol 1,2-dioxygenase from rhodococcus opacus 1cp in complex with 4-methylcatechol (see paper)
41% identity, 54% coverage: 112:280/313 of query aligns to 77:244/256 of 3hjsA
Sites not aligning to the query:
3hjqA Crystal structure of catechol 1,2-dioxygenase from rhodococcus opacus 1cp in complex with 3-methylcatechol (see paper)
41% identity, 54% coverage: 112:280/313 of query aligns to 77:244/256 of 3hjqA
Sites not aligning to the query:
3hhyA Crystal structure determination of catechol 1,2-dioxygenase from rhodococcus opacus 1cp in complex with catechol (see paper)
41% identity, 54% coverage: 112:280/313 of query aligns to 77:244/256 of 3hhyA
Sites not aligning to the query:
3hhxA Crystal structure determination of catechol 1,2-dioxygenase from rhodococcus opacus 1cp in complex with pyrogallol (see paper)
41% identity, 54% coverage: 112:280/313 of query aligns to 77:244/256 of 3hhxA
Sites not aligning to the query:
3hj8A Crystal structure determination of catechol 1,2-dioxygenase from rhodococcus opacus 1cp in complex with 4-chlorocatechol (see paper)
41% identity, 54% coverage: 112:280/313 of query aligns to 78:245/257 of 3hj8A
Sites not aligning to the query:
3hgiA Crystal structure of catechol 1,2-dioxygenase from the gram-positive rhodococcus opacus 1cp (see paper)
41% identity, 54% coverage: 112:280/313 of query aligns to 79:246/258 of 3hgiA
1dmhA Structure of catechol 1,2-dioxygenase from acinetobacter sp. Adp1 with bound 4-methylcatechol (see paper)
31% identity, 88% coverage: 37:312/313 of query aligns to 27:303/309 of 1dmhA
1dltA Structure of catechol 1,2-dioxygenase from acinetobacter sp. Adp1 with bound catechol (see paper)
31% identity, 88% coverage: 37:312/313 of query aligns to 27:303/309 of 1dltA
1dlmA Structure of catechol 1,2-dioxygenase from acinetobacter calcoaceticus native data (see paper)
31% identity, 88% coverage: 37:312/313 of query aligns to 27:303/309 of 1dlmA
P07773 Catechol 1,2-dioxygenase; 1,2-CTD; EC 1.13.11.1 from Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) (see paper)
31% identity, 88% coverage: 37:312/313 of query aligns to 29:305/311 of P07773
3th1A Crystal structure of chlorocatechol 1,2-dioxygenase from pseudomonas putida
33% identity, 74% coverage: 35:265/313 of query aligns to 2:222/246 of 3th1A
5td3A Crystal structure of catechol 1,2-dioxygenase from burkholderia vietnamiensis
31% identity, 77% coverage: 21:262/313 of query aligns to 11:253/307 of 5td3A
>WP_086509475.1 NCBI__GCF_002151265.1:WP_086509475.1
MFELPNKEDIVPHGIPQTPDDITEIVLKAMSHTRDERLREILTALVKHLHAFGREVKLSE
EEFMAAINAVTRLGHLTRDRHNETMVMSDALGFSTLVMILNQERTPEQISPALLGPFYSR
KDPEYPLGFNISRDTPKASDIPLFVSGRVTSRDGTPLPGALVEVWHASPEGLYENQDDSQ
PHLNLRGKFRTDAEGRYRFRTIRPASYPIPTHGIVGEMLEAQSRHPFRAAHLHFTVSAEG
HRTLVTQIFPKDDPFLESDCVFGVTSADLAMEFPIHDDGQAPDPDVRGRYCTLEVDFDLS
PGVSRLPASPIDS
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory