SitesBLAST
Comparing WP_086509503.1 NCBI__GCF_002151265.1:WP_086509503.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2vu2A Biosynthetic thiolase from z. Ramigera. Complex with s-pantetheine-11- pivalate. (see paper)
47% identity, 98% coverage: 5:393/396 of query aligns to 1:387/389 of 2vu2A
- active site: C86 (= C91), H345 (= H351), C375 (= C381), G377 (= G383)
- binding (3R)-3-hydroxy-2,2-dimethyl-4-oxo-4-({3-oxo-3-[(2-sulfanylethyl)amino]propyl}amino)butyl 2,2-dimethylpropanoate: H153 (= H159), M154 (= M160), F232 (= F238), S244 (= S250), G245 (= G251), F316 (= F322), H345 (= H351)
2vu1A Biosynthetic thiolase from z. Ramigera. Complex of with o-pantheteine- 11-pivalate. (see paper)
47% identity, 98% coverage: 5:393/396 of query aligns to 3:389/391 of 2vu1A
1dm3A Acetylated biosynthetic thiolase from zoogloea ramigera in complex with acetyl-coa (see paper)
47% identity, 98% coverage: 5:393/396 of query aligns to 1:387/389 of 1dm3A
- active site: C86 (= C91), H345 (= H351), C375 (= C381), G377 (= G383)
- binding acetyl coenzyme *a: C86 (= C91), L145 (= L151), H153 (= H159), M154 (= M160), R217 (= R223), S224 (≠ D230), M225 (≠ L231), A240 (= A246), S244 (= S250), M285 (= M291), A315 (= A321), F316 (= F322), H345 (= H351), C375 (= C381)
1dlvA Biosynthetic thiolase from zoogloea ramigera in complex with coa (see paper)
47% identity, 98% coverage: 5:393/396 of query aligns to 1:387/389 of 1dlvA
- active site: C86 (= C91), H345 (= H351), C375 (= C381), G377 (= G383)
- binding coenzyme a: C86 (= C91), L145 (= L151), H153 (= H159), M154 (= M160), R217 (= R223), L228 (= L234), A240 (= A246), S244 (= S250), H345 (= H351)
1ou6A Biosynthetic thiolase from zoogloea ramigera in complex with acetyl-o- pantetheine-11-pivalate
47% identity, 98% coverage: 5:393/396 of query aligns to 4:390/392 of 1ou6A
- active site: C89 (= C91), H348 (= H351), C378 (= C381), G380 (= G383)
- binding pantothenyl-aminoethanol-acetate pivalic acid: L148 (= L151), H156 (= H159), M157 (= M160), F235 (= F238), A243 (= A246), S247 (= S250), A318 (= A321), F319 (= F322), H348 (= H351)
P45359 Acetyl-CoA acetyltransferase; Acetoacetyl-CoA thiolase; CaTHL; EC 2.3.1.9 from Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) (see paper)
45% identity, 99% coverage: 3:395/396 of query aligns to 1:392/392 of P45359
- V77 (≠ E80) mutation to Q: 3-fold increase in thiolase activity, prevents disulfide bond formation under oxidized condition and results in the loss of regulatory mechanism based on redox-switch modulation; when associated with Y-153 and K-286.
- C88 (= C91) modified: Disulfide link with 378, In inhibited form
- S96 (≠ L99) binding
- N153 (≠ G156) mutation to Y: 3-fold increase in thiolase activity, prevents disulfide bond formation under oxidized condition and results in the loss of regulatory mechanism based on redox-switch modulation; when associated with Q-77 and K-286.
- GS 279:280 (≠ ST 282:283) binding
- A286 (≠ G289) mutation to K: 3-fold increase in thiolase activity, prevents disulfide bond formation under oxidized condition and results in the loss of regulatory mechanism based on redox-switch modulation; when associated with Q-77 and Y-153.
- C378 (= C381) modified: Disulfide link with 88, In inhibited form
- A386 (= A389) binding
2wkuA Biosynthetic thiolase from z. Ramigera. The n316h mutant. (see paper)
47% identity, 98% coverage: 5:393/396 of query aligns to 1:387/389 of 2wkuA
- active site: C86 (= C91), H345 (= H351), C375 (= C381), G377 (= G383)
- binding D-mannose: S6 (≠ G10), A7 (≠ S11), R38 (= R42), K182 (= K188), D194 (≠ E200), V280 (= V286), D281 (≠ E287), T287 (≠ L293), P331 (≠ A337), S332 (≠ E338), V334 (≠ L340), V336 (≠ P342), F360 (≠ A366)
P07097 Acetyl-CoA acetyltransferase; Acetoacetyl-CoA thiolase; Beta-ketothiolase; EC 2.3.1.9 from Shinella zoogloeoides (Crabtreella saccharophila) (see 2 papers)
46% identity, 98% coverage: 7:393/396 of query aligns to 6:390/392 of P07097
- Q64 (≠ A66) mutation to A: Slightly lower activity.
- C89 (= C91) mutation to A: Loss of activity.
- C378 (= C381) mutation to G: Loss of activity.
1m1oA Crystal structure of biosynthetic thiolase, c89a mutant, complexed with acetoacetyl-coa (see paper)
47% identity, 98% coverage: 5:393/396 of query aligns to 2:388/390 of 1m1oA
- active site: A87 (≠ C91), H346 (= H351), C376 (= C381), G378 (= G383)
- binding acetoacetyl-coenzyme a: L86 (= L90), A87 (≠ C91), L146 (= L151), H154 (= H159), M155 (= M160), R218 (= R223), S225 (≠ D230), M226 (≠ L231), A241 (= A246), G242 (= G247), S245 (= S250), A316 (= A321), F317 (= F322), H346 (= H351), I377 (= I382), G378 (= G383)
4xl4A Crystal structure of thiolase from clostridium acetobutylicum in complex with coa (see paper)
45% identity, 99% coverage: 3:395/396 of query aligns to 1:392/392 of 4xl4A
- active site: C88 (= C91), H348 (= H351), S378 (≠ C381), G380 (= G383)
- binding coenzyme a: L148 (= L151), H156 (= H159), R220 (= R223), L231 (= L234), A243 (= A246), S247 (= S250), F319 (= F322), H348 (= H351)
P14611 Acetyl-CoA acetyltransferase; Acetoacetyl-CoA thiolase; Beta-ketothiolase; EC 2.3.1.9 from Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337) (Ralstonia eutropha) (see paper)
45% identity, 99% coverage: 3:394/396 of query aligns to 1:392/393 of P14611
- C88 (= C91) active site, Acyl-thioester intermediate; mutation to S: Almost complete loss of acetoacetyl-CoA thiolase activity.
- H156 (= H159) mutation to A: Almost complete loss of acetoacetyl-CoA thiolase activity.
- F219 (≠ H221) mutation to A: About 50% loss of acetoacetyl-CoA thiolase activity.; mutation to Y: 2-fold increase of acetoacetyl-CoA thiolase activity.
- R221 (= R223) mutation to A: Almost complete loss of acetoacetyl-CoA thiolase activity.
- S248 (= S250) mutation to A: About 40% loss of acetoacetyl-CoA thiolase activity.
- H349 (= H351) mutation to A: Almost complete loss of acetoacetyl-CoA thiolase activity.
- C379 (= C381) mutation to S: Almost complete loss of acetoacetyl-CoA thiolase activity.
4o9cC Crystal structure of beta-ketothiolase (phaa) from ralstonia eutropha h16 (see paper)
45% identity, 99% coverage: 3:394/396 of query aligns to 1:392/393 of 4o9cC
- active site: S88 (≠ C91), H349 (= H351), C379 (= C381), G381 (= G383)
- binding coenzyme a: S88 (≠ C91), L148 (= L151), R221 (= R223), F236 (= F238), A244 (= A246), S248 (= S250), L250 (≠ I252), A319 (= A321), F320 (= F322), H349 (= H351)
5f38D X-ray crystal structure of a thiolase from escherichia coli at 1.8 a resolution (see paper)
46% identity, 99% coverage: 3:394/396 of query aligns to 3:394/394 of 5f38D
- active site: C90 (= C91), A348 (≠ G348), A378 (≠ I378), L380 (= L380)
- binding [(3~{S})-2,2-dimethyl-3-oxidanyl-4-oxidanylidene-4-[[3-oxidanylidene-3-(2-sulfanylethylamino)propyl]amino]butyl] phosphono hydrogen phosphate: C90 (= C91), L151 (≠ V150), A246 (= A246), S250 (= S250), I252 (= I252), A321 (= A321), F322 (= F322), H351 (= H351)
Q9BWD1 Acetyl-CoA acetyltransferase, cytosolic; Acetyl-CoA transferase-like protein; Cytosolic acetoacetyl-CoA thiolase; EC 2.3.1.9 from Homo sapiens (Human) (see 2 papers)
42% identity, 99% coverage: 4:394/396 of query aligns to 6:396/397 of Q9BWD1
- K211 (= K211) to R: in dbSNP:rs25683
- R223 (= R223) binding
- S226 (≠ V226) binding
- S252 (= S250) binding
1wl4A Human cytosolic acetoacetyl-coa thiolase complexed with coa (see paper)
42% identity, 99% coverage: 4:394/396 of query aligns to 3:393/394 of 1wl4A
- active site: C89 (= C91), H350 (= H351), C380 (= C381), G382 (= G383)
- binding coenzyme a: L148 (= L151), M157 (= M160), R220 (= R223), Y234 (≠ A237), P245 (≠ A246), A246 (≠ G247), S249 (= S250), A320 (= A321), F321 (= F322), H350 (= H351)
5f38B X-ray crystal structure of a thiolase from escherichia coli at 1.8 a resolution (see paper)
46% identity, 99% coverage: 3:394/396 of query aligns to 1:390/391 of 5f38B
- active site: C88 (= C91), H347 (= H351), C377 (= C381), G379 (= G383)
- binding coenzyme a: C88 (= C91), L149 (≠ V150), K219 (≠ R223), F234 (= F238), A242 (= A246), S246 (= S250), A317 (= A321), F318 (= F322), H347 (= H351)
P42765 3-ketoacyl-CoA thiolase, mitochondrial; Acetyl-CoA acetyltransferase; Acetyl-CoA acyltransferase; Acyl-CoA hydrolase, mitochondrial; Beta-ketothiolase; Mitochondrial 3-oxoacyl-CoA thiolase; T1; EC 2.3.1.16; EC 2.3.1.9; EC 3.1.2.-; EC 3.1.2.1; EC 3.1.2.2 from Homo sapiens (Human) (see paper)
38% identity, 99% coverage: 3:396/396 of query aligns to 4:397/397 of P42765
- C92 (= C91) mutation to A: Decreased acyl-CoA hydrolase activity.; mutation to S: Decreased acyl-CoA hydrolase activity; when associated with A-382.
- R224 (= R223) binding
- T227 (≠ V226) binding
- S251 (= S250) binding
- C382 (= C381) mutation to S: Decreased acyl-CoA hydrolase activity; when associated with S-92.
4c2jD Crystal structure of human mitochondrial 3-ketoacyl-coa thiolase in complex with coa (see paper)
38% identity, 99% coverage: 3:393/396 of query aligns to 7:393/395 of 4c2jD
7feaB Py14 in complex with col-d (see paper)
43% identity, 99% coverage: 4:395/396 of query aligns to 3:393/396 of 7feaB
7ei4A Crystal structure of masl in complex with a novel covalent inhibitor, collimonin c (see paper)
43% identity, 99% coverage: 4:395/396 of query aligns to 2:390/392 of 7ei4A
Query Sequence
>WP_086509503.1 NCBI__GCF_002151265.1:WP_086509503.1
MRLDSVVILGSARTAIGSFGGSLAGLAPHELGTVTAREALARAGVEAGAIDHAVYGHIIT
TGPQDAYLARHIALDAGVPEGAAAFNVNRLCGSGVQAILSAAQQIVLGDSRLALAGGAES
MSRGAYLLPPQARNGLRMGHASVTDLTLGVLSDPFGSGHMGVTAENIAKRCGLEREAIDR
FALESHHKAARAIAEGRFEEQIVPVTVREGKNERQFARDEHVRDGVTLEDLARLKPAFAK
EGVVTAGNASGINDGAASLVLAHADEASRRGLAPRARLICASTAGVEPGLMGLGPIPAVR
RCLDEAGLSIADIDVIESNEAFAAQAMAVAQELDFPAERLNPNGGAVGLGHPVGATGAIL
TIKALAELERTGGRYGLITLCIGGGQGIALLIERCA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory