SitesBLAST
Comparing WP_086509516.1 NCBI__GCF_002151265.1:WP_086509516.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q9CPU0 Lactoylglutathione lyase; Aldoketomutase; Glyoxalase I; Glx I; Ketone-aldehyde mutase; Methylglyoxalase; S-D-lactoylglutathione methylglyoxal lyase; EC 4.4.1.5 from Mus musculus (Mouse) (see paper)
49% identity, 92% coverage: 14:175/177 of query aligns to 23:183/184 of Q9CPU0
- Q34 (≠ H25) binding
- E100 (= E92) binding
- H127 (= H119) binding in other chain
- E173 (= E165) binding in other chain
4kykA Crystal structure of mouse glyoxalase i complexed with indomethacin (see paper)
49% identity, 92% coverage: 14:175/177 of query aligns to 18:178/179 of 4kykA
2za0A Crystal structure of mouse glyoxalase i complexed with methyl-gerfelin (see paper)
49% identity, 92% coverage: 14:175/177 of query aligns to 20:180/180 of 2za0A
- active site: Q31 (≠ H25), E97 (= E92), H124 (= H119), E170 (= E165)
- binding methyl 4-(2,3-dihydroxy-5-methylphenoxy)-2-hydroxy-6-methylbenzoate: Q31 (≠ H25), F65 (= F59), L67 (= L61), F90 (= F85), E97 (= E92), H124 (= H119), M155 (= M150), E170 (= E165)
- binding zinc ion: Q31 (≠ H25), E97 (= E92), H124 (= H119), E170 (= E165)
6l0uB Crystal structure of mouse glyoxalase i complexed with a small molecule inhibitor
49% identity, 92% coverage: 14:175/177 of query aligns to 16:176/177 of 6l0uB
- active site: Q27 (≠ H25), E93 (= E92), H120 (= H119), E166 (= E165)
- binding N-[4-(trifluoromethyloxy)phenyl]-1,3,4,9-tetrahydropyrido[3,4-b]indole-2-carbothioamide: R116 (≠ Q115), K144 (= K143), D148 (≠ Q147), G149 (= G148), W164 (= W163)
- binding zinc ion: Q27 (≠ H25), E93 (= E92), H120 (= H119), E166 (= E165)
4kykB Crystal structure of mouse glyoxalase i complexed with indomethacin (see paper)
49% identity, 92% coverage: 14:175/177 of query aligns to 16:176/177 of 4kykB
- active site: Q27 (≠ H25), E93 (= E92), H120 (= H119), E166 (= E165)
- binding indomethacin: K144 (= K143), K150 (= K149), M151 (= M150), L154 (≠ V153), F156 (= F155)
- binding zinc ion: Q27 (≠ H25), E93 (= E92), H120 (= H119), E166 (= E165)
4kyhA Crystal structure of mouse glyoxalase i complexed with zopolrestat (see paper)
50% identity, 91% coverage: 14:174/177 of query aligns to 18:177/177 of 4kyhA
- active site: Q29 (≠ H25), E95 (= E92), H122 (= H119), E168 (= E165)
- binding zinc ion: Q29 (≠ H25), E95 (= E92), H122 (= H119), E168 (= E165)
- binding 3,4-dihydro-4-oxo-3-((5-trifluoromethyl-2-benzothiazolyl)methyl)-1-phthalazine acetic acid: M31 (= M27), R33 (= R29), F63 (= F59), E95 (= E92), T97 (= T94), N99 (= N96)
4x2aA Crystal structure of mouse glyoxalase i complexed with baicalein (see paper)
50% identity, 90% coverage: 14:173/177 of query aligns to 9:167/167 of 4x2aA
- active site: Q20 (≠ H25), E86 (= E92), H113 (= H119), E159 (= E165)
- binding 5,6,7-trihydroxy-2-phenyl-4H-chromen-4-one: Q20 (≠ H25), F49 (= F54), L56 (= L61), F79 (= F85), E86 (= E92), H113 (= H119), M144 (= M150), E159 (= E165), I166 (≠ L172), A167 (≠ S173)
- binding zinc ion: Q20 (≠ H25), E86 (= E92), H113 (= H119), E159 (= E165)
4pv5A Crystal structure of mouse glyoxalase i in complexed with 18-beta- glycyrrhetinic acid (see paper)
50% identity, 91% coverage: 14:174/177 of query aligns to 11:170/170 of 4pv5A
4opnA Crystal structure of mouse glyoxalase i complexed with mah
50% identity, 90% coverage: 14:172/177 of query aligns to 15:172/172 of 4opnA
- active site: Q26 (≠ H25), E92 (= E92), H119 (= H119), E165 (= E165)
- binding L-gamma-glutamyl-N-(3-ethynylphenyl)-N-hydroxy-L-glutaminylglycine: Q26 (≠ H25), R30 (= R29), F60 (= F59), F85 (= F85), E92 (= E92), T94 (= T94), N96 (= N96), R115 (≠ Q115), H119 (= H119), K143 (= K143), K149 (= K149), M150 (= M150), L153 (≠ V153), E165 (= E165), I172 (≠ L172)
- binding zinc ion: Q26 (≠ H25), E92 (= E92)
7wt0A Human glyoxalase i (with c-ter his tag) in complex with tlsc702 (see paper)
49% identity, 89% coverage: 18:175/177 of query aligns to 26:182/185 of 7wt0A
- binding (~{E})-3-(1,3-benzothiazol-2-yl)-4-(4-methoxyphenyl)but-3-enoic acid: C60 (≠ L52), F62 (= F54), L69 (= L61), F71 (= F63), L92 (≠ F85), E99 (= E92), H126 (= H119), K150 (= K143), M157 (= M150), L160 (≠ V153), F162 (= F155), E172 (= E165), M179 (≠ L172)
- binding zinc ion: Q33 (≠ H25), E99 (= E92), H126 (= H119), E172 (= E165)
Sites not aligning to the query:
Q04760 Lactoylglutathione lyase; Aldoketomutase; Glyoxalase I; Glx I; Ketone-aldehyde mutase; Methylglyoxalase; S-D-lactoylglutathione methylglyoxal lyase; EC 4.4.1.5 from Homo sapiens (Human) (see 12 papers)
49% identity, 89% coverage: 18:175/177 of query aligns to 27:183/184 of Q04760
- Q34 (≠ H25) binding ; mutation to E: Reduces enzyme activity by 99%.
- S45 (≠ A36) mutation to A: No effect on phosphorylation.
- C61 (≠ L52) modified: Disulfide link with 139, Alternate; mutation to A: No effect on NO-mediated modification.
- S69 (= S60) mutation to A: No effect on phosphorylation.
- S94 (= S86) mutation to A: No effect on phosphorylation.
- T98 (≠ L90) mutation to A: No effect on phosphorylation.
- E100 (= E92) binding ; mutation to Q: Reduces enzyme activity by over 99%.
- T102 (= T94) mutation to A: No effect on phosphorylation.
- T107 (= T99) modified: Phosphothreonine; mutation to A: Loss of phosphorylation.
- E111 (≠ D103) to A: in dbSNP:rs4746
- H127 (= H119) binding in other chain
- C139 (≠ E131) modified: S-glutathionyl cysteine; alternate; modified: Disulfide link with 61, Alternate; mutation to A: Impaired NO-mediated modification. Loss of NO-mediated modification; when associated with A-19 or A-20.
- E173 (= E165) active site, Proton donor/acceptor; binding in other chain; mutation to Q: Abolishes enzyme activity.
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 2 modified: N-acetylalanine
- 19 modified: Disulfide link with 20; C → Y: in dbSNP:rs17855424; C→A: No effect on NO-mediated modification. Impaired NO-mediated modification; when associated with A-20. Loss of NO-mediated modification; when associated with A-139.
- 20 modified: Disulfide link with 19; C→A: No effect on NO-mediated modification. Impaired NO-mediated modification; when associated with A-19. Loss of NO-mediated modification; when associated with A-139.
3w0tA Human glyoxalase i with an n-hydroxypyridone derivative inhibitor
49% identity, 89% coverage: 18:175/177 of query aligns to 19:175/176 of 3w0tA
- active site: Q26 (≠ H25), E92 (= E92), H119 (= H119), E165 (= E165)
- binding N-[3-(1-hydroxy-6-oxo-4-phenyl-1,6-dihydropyridin-2-yl)phenyl]methanesulfonamide: Q26 (≠ H25), F55 (= F54), F60 (= F59), L62 (= L61), F64 (= F63), E92 (= E92), H119 (= H119), E165 (= E165), M172 (≠ L172)
- binding zinc ion: Q26 (≠ H25), E92 (= E92), H119 (= H119), E165 (= E165)
Sites not aligning to the query:
3vw9A Human glyoxalase i with an n-hydroxypyridone inhibitor (see paper)
49% identity, 89% coverage: 18:175/177 of query aligns to 19:175/176 of 3vw9A
- active site: Q26 (≠ H25), E92 (= E92), H119 (= H119), E165 (= E165)
- binding 1-hydroxy-6-[1-(3-methoxypropyl)-1H-pyrrolo[2,3-b]pyridin-5-yl]-4-phenylpyridin-2(1H)-one: Q26 (≠ H25), C53 (≠ L52), L62 (= L61), E92 (= E92), H119 (= H119), M150 (= M150), F155 (= F155), E165 (= E165), M172 (≠ L172)
- binding zinc ion: Q26 (≠ H25), E92 (= E92), H119 (= H119), E165 (= E165)
Sites not aligning to the query:
1qipA Human glyoxalase i complexed with s-p- nitrobenzyloxycarbonylglutathione (see paper)
49% identity, 89% coverage: 18:175/177 of query aligns to 19:175/176 of 1qipA
- active site: Q26 (≠ H25), E92 (= E92), H119 (= H119), E165 (= E165)
- binding s-p-nitrobenzyloxycarbonylglutathione: R30 (= R29), Q51 (≠ R50), C53 (≠ L52), F60 (= F59), F64 (= F63), I81 (≠ T81), L85 (≠ F85), T94 (= T94), N96 (= N96), R115 (≠ Q115), M150 (= M150), F155 (= F155), M172 (≠ L172)
- binding zinc ion: Q26 (≠ H25), E92 (= E92), H119 (= H119), E165 (= E165)
1qinA Human glyoxalase i complexed with s-(n-hydroxy-n-p- iodophenylcarbamoyl) glutathione (see paper)
49% identity, 89% coverage: 18:175/177 of query aligns to 19:175/176 of 1qinA
- active site: Q26 (≠ H25), E92 (= E92), H119 (= H119), E165 (= E165)
- binding s-(n-hydroxy-n-iodophenylcarbamoyl)glutathione: Q26 (≠ H25), R30 (= R29), F60 (= F59), L62 (= L61), F64 (= F63), E92 (= E92), T94 (= T94), N96 (= N96), R115 (≠ Q115), H119 (= H119), K143 (= K143), G148 (= G148), K149 (= K149), M150 (= M150), E165 (= E165), M172 (≠ L172)
- binding zinc ion: Q26 (≠ H25), E92 (= E92)
1froA Human glyoxalase i with benzyl-glutathione inhibitor (see paper)
49% identity, 89% coverage: 18:175/177 of query aligns to 19:175/176 of 1froA
- active site: Q26 (≠ H25), E92 (= E92), H119 (= H119), E165 (= E165)
- binding s-benzyl-glutathione: R30 (= R29), F60 (= F59), T94 (= T94), N96 (= N96), R115 (≠ Q115), M150 (= M150), F155 (= F155), E165 (= E165)
- binding zinc ion: Q26 (≠ H25), E92 (= E92), H119 (= H119), E165 (= E165)
Sites not aligning to the query:
3w0uA Human glyoxalase i with an n-hydroxypyridone inhibitor
49% identity, 89% coverage: 18:175/177 of query aligns to 19:175/175 of 3w0uA
- active site: Q26 (≠ H25), E92 (= E92), H119 (= H119), E165 (= E165)
- binding N-[3-(1-Hydroxy-6-oxo-4-phenyl-1,6-dihydro-pyridin-2-yl)-5-methanesulfonylamino-phenyl]-methanesulfonamide: Q26 (≠ H25), F60 (= F59), L62 (= L61), E92 (= E92), H119 (= H119), K143 (= K143), M150 (= M150), E165 (= E165), M172 (≠ L172)
- binding zinc ion: Q26 (≠ H25), E92 (= E92), H119 (= H119), E165 (= E165)
7wszA Human glyoxalase i (with c-ter his tag) in glycerol-bound form (see paper)
49% identity, 89% coverage: 18:175/177 of query aligns to 19:175/183 of 7wszA
Sites not aligning to the query:
1bh5A Human glyoxalase i q33e, e172q double mutant (see paper)
48% identity, 89% coverage: 18:175/177 of query aligns to 20:176/177 of 1bh5A
- active site: E27 (≠ H25), E93 (= E92), H120 (= H119), Q166 (≠ E165)
- binding s-hexylglutathione: R31 (= R29), F61 (= F59), L63 (= L61), T95 (= T94), N97 (= N96), R116 (≠ Q115), M151 (= M150), F156 (= F155)
- binding zinc ion: E27 (≠ H25), E93 (= E92), H120 (= H119), Q166 (≠ E165)
P50107 Glyoxalase I; Glx I; Aldoketomutase; Ketone-aldehyde mutase; Methylglyoxalase; S-D-lactoylglutathione methylglyoxal lyase; actoylglutathione lyase; EC 4.4.1.5 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
45% identity, 97% coverage: 1:171/177 of query aligns to 1:169/326 of P50107
- E163 (= E165) active site, Proton donor/acceptor
Sites not aligning to the query:
- 318 active site, Proton donor/acceptor
Query Sequence
>WP_086509516.1 NCBI__GCF_002151265.1:WP_086509516.1
MSFKGEQHPGVQTPTADSQGFRLNHTMLRVKDPEKALAFYTRVFGMRVMRRLDFEEMSFS
LYFLARLDDGEQVPEDQGERTVWTFSQTGLLELTHNWGTESQDDFAYHDGNAQPQGFGHI
CFSVPDLDAAEAWFDANDVTFVKRSDQGKMKDVIFVKDVDGYWIEVIQADRLSALGD
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory