Comparing WP_086509530.1 NCBI__GCF_002151265.1:WP_086509530.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P07821 Iron(3+)-hydroxamate import ATP-binding protein FhuC; Ferric hydroxamate uptake protein C; Ferrichrome transport ATP-binding protein FhuC; Iron(III)-hydroxamate import ATP-binding protein FhuC; EC 7.2.2.16 from Escherichia coli (strain K12) (see 2 papers)
46% identity, 91% coverage: 6:249/269 of query aligns to 12:256/265 of P07821
5x40A Structure of a cbio dimer bound with amppcp (see paper)
38% identity, 84% coverage: 6:230/269 of query aligns to 5:229/280 of 5x40A
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
33% identity, 84% coverage: 6:230/269 of query aligns to 3:225/241 of 4u00A
3fvqB Crystal structure of the nucleotide binding domain fbpc complexed with atp (see paper)
36% identity, 87% coverage: 11:245/269 of query aligns to 9:237/350 of 3fvqB
Q9JI39 ATP-binding cassette sub-family B member 10, mitochondrial; ABC-mitochondrial erythroid protein; ABC-me protein; ATP-binding cassette transporter 10; ABC transporter 10 protein from Mus musculus (Mouse) (see 2 papers)
35% identity, 84% coverage: 18:244/269 of query aligns to 472:701/715 of Q9JI39
Sites not aligning to the query:
1vciA Crystal structure of the atp-binding cassette of multisugar transporter from pyrococcus horikoshii ot3 complexed with atp (see paper)
30% identity, 83% coverage: 5:228/269 of query aligns to 6:216/353 of 1vciA
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
29% identity, 83% coverage: 6:228/269 of query aligns to 2:223/240 of 4ymuJ
G7CBF5 Mycobactin import ATP-binding/permease protein IrtA; EC 7.2.2.- from Mycolicibacterium thermoresistibile (strain ATCC 19527 / DSM 44167 / CIP 105390 / JCM 6362 / NCTC 10409 / 316) (Mycobacterium thermoresistibile) (see paper)
36% identity, 86% coverage: 18:247/269 of query aligns to 667:894/908 of G7CBF5
Sites not aligning to the query:
4ayxA Structure of the human mitochondrial abc transporter, abcb10 (rod form b) (see paper)
35% identity, 79% coverage: 18:230/269 of query aligns to 354:567/571 of 4ayxA
Sites not aligning to the query:
7y48B Cryo-em structure of biliverdin-bound mitochondrial abc transporter abcb10 from biortus
35% identity, 79% coverage: 18:230/269 of query aligns to 353:563/567 of 7y48B
Sites not aligning to the query:
Q9NRK6 ATP-binding cassette sub-family B member 10, mitochondrial; ABC-mitochondrial erythroid protein; ABC-me protein; ATP-binding cassette transporter 10; ABC transporter 10 protein; Mitochondrial ATP-binding cassette 2; M-ABC2 from Homo sapiens (Human) (see 5 papers)
34% identity, 83% coverage: 18:239/269 of query aligns to 507:731/738 of Q9NRK6
Sites not aligning to the query:
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
35% identity, 78% coverage: 20:228/269 of query aligns to 32:235/378 of P69874
Sites not aligning to the query:
P9WQJ9 Mycobactin import ATP-binding/permease protein IrtA; Iron-regulated transporter A; EC 7.2.2.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
37% identity, 79% coverage: 11:223/269 of query aligns to 615:825/859 of P9WQJ9
Sites not aligning to the query:
7wixA Cryo-em structure of mycobacterium tuberculosis irtab in complex with adp (see paper)
37% identity, 79% coverage: 18:229/269 of query aligns to 348:556/571 of 7wixA
Sites not aligning to the query:
7wivA Cryo-em structure of mycobacterium tuberculosis irtab in complex with an amp-pnp (see paper)
37% identity, 79% coverage: 18:229/269 of query aligns to 348:556/571 of 7wivA
Sites not aligning to the query:
7wixB Cryo-em structure of mycobacterium tuberculosis irtab in complex with adp (see paper)
37% identity, 82% coverage: 10:230/269 of query aligns to 333:553/576 of 7wixB
7wiwA Cryo-em structure of mycobacterium tuberculosis irtab complexed with atp in an occluded conformation (see paper)
37% identity, 79% coverage: 18:229/269 of query aligns to 348:556/570 of 7wiwA
Sites not aligning to the query:
3puyA Crystal structure of an outward-facing mbp-maltose transporter complex bound to amp-pnp after crystal soaking of the pretranslocation state (see paper)
32% identity, 82% coverage: 9:228/269 of query aligns to 6:220/371 of 3puyA
3puxA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-bef3 (see paper)
32% identity, 82% coverage: 9:228/269 of query aligns to 6:220/371 of 3puxA
3puwA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-alf4 (see paper)
32% identity, 82% coverage: 9:228/269 of query aligns to 6:220/371 of 3puwA
>WP_086509530.1 NCBI__GCF_002151265.1:WP_086509530.1
MTRHELATRDLSLGYGRITIIDELALSLPTGQVTAIVGPNGCGKSTLLAGLARLHAPSHG
AVLLDGQDIQQLPARELARRLALLPQEASAPEGLTVAELVRFGRQPHQGWLRQWSAEDQQ
VVHEALAAADVDELADRPLDTLSGGQRQRAWIAMTITQQTPLLLLDEPTSALDLGHQIEV
FELVRRLAAHGRTVVMVLHDLASACRYADHLVALRHGQLVAAGPPGEVVTTELVRQLYDI
DCTLIPDPATGSLLLANVRRAPRFNIHPS
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory