Comparing WP_086509567.1 NCBI__GCF_002151265.1:WP_086509567.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 8 hits to proteins with known functional sites (download)
8hkbA Tpa bound-form of periplasmic terephthalate binding protein (tbp) from ideonella sakaiensis mutant k184d (see paper)
25% identity, 86% coverage: 38:325/333 of query aligns to 5:288/302 of 8hkbA
7ndrD Crystal structure of tphc in an open conformation (see paper)
23% identity, 86% coverage: 38:325/333 of query aligns to 5:288/293 of 7ndrD
7ndsA Crystal structure of tphc in a closed conformation (see paper)
23% identity, 86% coverage: 38:325/333 of query aligns to 5:288/294 of 7ndsA
2dvzA Structure of a periplasmic transporter (see paper)
24% identity, 85% coverage: 34:317/333 of query aligns to 3:284/300 of 2dvzA
5okuA R. Palustris rpa4515 with adipate (see paper)
25% identity, 81% coverage: 31:299/333 of query aligns to 1:265/299 of 5okuA
5oeiA R. Palustris rpa4515 with oxoadipate (see paper)
25% identity, 81% coverage: 31:299/333 of query aligns to 1:265/299 of 5oeiA
2f5xB Structure of periplasmic binding protein bugd (see paper)
23% identity, 89% coverage: 34:330/333 of query aligns to 3:297/300 of 2f5xB
6hkeB Matc (rpa3494) from rhodopseudomonas palustris with bound malate (see paper)
25% identity, 68% coverage: 75:301/333 of query aligns to 41:266/296 of 6hkeB
Sites not aligning to the query:
>WP_086509567.1 NCBI__GCF_002151265.1:WP_086509567.1
MTAKQHLTRFSAIVLPLAAVVGMSSAAQADEWTPTRNIEFIAPANPGGGWDTLVRTTSRV
IQEEGLAERSFGAINVPGGGGAVAWAQIARDSGNPHKLFATSPPIILVPLAGASRYDHTS
FTPIARLITDYSIVLVRNDSPYEDLPSLIEAMEQNPQLSVGGGSAPGSMDHISMAGLAAA
AGLNASDVNYIPFSGGGEAMTSLMGGHVEAVITGAGEASGQLGENSQIRALGVSAPERLG
GALAEVPTYQEQDIDYTFDIWRGVMGTPDMPAEAVAYYEDLFAQMLETDGWQQAREQLGW
IDAYQDSEEFGAFLDEQKEQFSTILGDLGLLGE
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory