Comparing WP_086509625.1 NCBI__GCF_002151265.1:WP_086509625.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q9I700 Beta-alanine--pyruvate aminotransferase; Beta-A--Py AT; Beta-alanine--pyruvate transaminase; Omega-amino acid aminotransferase; Omega-amino acid AT; Omega-amino acid--pyruvate aminotransferase; Omega-APT; EC 2.6.1.18 from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see paper)
65% identity, 97% coverage: 12:443/446 of query aligns to 13:445/448 of Q9I700
4b98A The structure of the omega aminotransferase from pseudomonas aeruginosa (see paper)
65% identity, 97% coverage: 12:443/446 of query aligns to 6:438/441 of 4b98A
4uhmA Characterization of a novel transaminase from pseudomonas sp. Strain aac (see paper)
65% identity, 96% coverage: 15:443/446 of query aligns to 3:432/435 of 4uhmA
3a8uX Crystal structure of omega-amino acid:pyruvate aminotransferase
63% identity, 97% coverage: 12:445/446 of query aligns to 5:440/441 of 3a8uX
Q9A3Q9 Omega-aminotransferase; Beta-alanine--pyruvate aminotransferase; EC 2.6.1.-; EC 2.6.1.18 from Caulobacter vibrioides (strain ATCC 19089 / CB15) (Caulobacter crescentus) (see paper)
53% identity, 97% coverage: 14:446/446 of query aligns to 7:439/439 of Q9A3Q9
5lhaA Amine transaminase crystal structure from an uncultivated pseudomonas species in the pmp-bound form
39% identity, 96% coverage: 19:444/446 of query aligns to 10:445/447 of 5lhaA
5lh9D Amine transaminase crystal structure from an uncultivated pseudomonas species in the plp-bound (internal aldimine) form
39% identity, 96% coverage: 19:444/446 of query aligns to 12:447/449 of 5lh9D
6gwiB The crystal structure of halomonas elongata amino-transferase (see paper)
36% identity, 95% coverage: 22:444/446 of query aligns to 17:444/450 of 6gwiB
6s54A Transaminase from pseudomonas fluorescens (see paper)
38% identity, 92% coverage: 30:441/446 of query aligns to 28:447/453 of 6s54A
Sites not aligning to the query:
7qx3A Structure of the transaminase tr2e2 with eos (see paper)
35% identity, 92% coverage: 34:444/446 of query aligns to 2:416/422 of 7qx3A
6fyqA The crystal structure of a new transaminase from the marine bacterium virgibacillus (see paper)
35% identity, 93% coverage: 27:442/446 of query aligns to 21:435/443 of 6fyqA
Sites not aligning to the query:
6io1B Crystal structure of a novel thermostable (s)-enantioselective omega- transaminase from thermomicrobium roseum (see paper)
37% identity, 95% coverage: 22:445/446 of query aligns to 19:446/448 of 6io1B
5ti8B Crystal structure of an aspartate aminotransferase from pseudomonas (see paper)
36% identity, 90% coverage: 34:436/446 of query aligns to 1:370/384 of 5ti8B
7qx0B Transaminase structure of plurienzyme (tr2e2) in complex with plp (see paper)
34% identity, 97% coverage: 14:444/446 of query aligns to 6:437/443 of 7qx0B
7ypmA Crystal structure of transaminase cc1012 complexed with plp and l- alanine (see paper)
35% identity, 93% coverage: 34:446/446 of query aligns to 31:448/454 of 7ypmA
5kr5A Directed evolution of transaminases by ancestral reconstruction. Using old proteins for new chemistries
37% identity, 92% coverage: 34:445/446 of query aligns to 31:452/455 of 5kr5A
D6R3B6 Vanillin aminotransferase; Putative aminotransferase; pAMT; EC 2.6.1.119 from Capsicum frutescens (Cayenne pepper) (Tabasco pepper) (see paper)
32% identity, 95% coverage: 22:446/446 of query aligns to 16:448/459 of D6R3B6
3i5tA Crystal structure of aminotransferase prk07036 from rhodobacter sphaeroides kd131
34% identity, 92% coverage: 35:445/446 of query aligns to 27:437/444 of 3i5tA
Sites not aligning to the query:
7ypnD Crystal structure of transaminase cc1012 mutant m9 complexed with plp (see paper)
34% identity, 93% coverage: 34:446/446 of query aligns to 31:448/455 of 7ypnD
4a6rA Crystal structure of the omega transaminase from chromobacterium violaceum in the apo form, crystallised from polyacrylic acid (see paper)
34% identity, 93% coverage: 34:446/446 of query aligns to 1:414/423 of 4a6rA
>WP_086509625.1 NCBI__GCF_002151265.1:WP_086509625.1
MSVHQSLHGGLSQEQLDAYWMPYTGNRQFKRDPRIIVGAEGSYFTDADGRRIFDGLSGLW
TCGAGHCRPEITEAVTRQLQQLDYSPAFQFGHPKAFELAHRIRGLMPQGLDHVFYTGSGS
ESADTALKIARAYWRKKGKPTKTKLVGRAKGYHGVNFGGISLGGIGANRVLFGQGIDADH
LPHTLLAENAFTKGMPERGAERAEELLELIALHDASNIAAVIVEPLAGSAGVIPPPKGYL
QRLREICDQHDILLIFDEVITGFGRMGSMTGAEEFGVVPDILNVAKQLTNGAVPMGAVIV
QGEIYHTFMEHGGPDYMLELPHGYTYSGHPVACAAALAALDVLENDRLIQRVREMSPVFE
EALHGLKGTRYISDIRNYGLAGALQIEPYPGEPARRPFEIAMKCWNKGFYVRYGGDTIQL
GLPFIVERDEIDRLVNALGEAISELD
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory