Comparing WP_086509657.1 NCBI__GCF_002151265.1:WP_086509657.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P0A962 L-asparaginase 1; L-asparaginase I; L-ASNase I; L-asparagine amidohydrolase I; EC 3.5.1.1 from Escherichia coli (strain K12) (see paper)
37% identity, 97% coverage: 9:349/350 of query aligns to 4:333/338 of P0A962
6nxcB Ecai(t162a) mutant in complex with citrate at ph 4 (see paper)
36% identity, 97% coverage: 9:349/350 of query aligns to 11:332/336 of 6nxcB
2himA Crystal structure and allosteric regulation of the cytoplasmic escherichia coli l-asparaginase i (see paper)
35% identity, 97% coverage: 9:349/350 of query aligns to 2:321/324 of 2himA
7r6bB Crystal structure of mutant r43d/l124d/r125a/c273s of l-asparaginase i from yersinia pestis (see paper)
35% identity, 97% coverage: 9:349/350 of query aligns to 2:298/301 of 7r6bB
4r8lA Crystal structure of the asp-bound guinea pig l-asparaginase 1 catalytic domain (see paper)
35% identity, 96% coverage: 8:343/350 of query aligns to 1:343/354 of 4r8lA
5dndD Crystal structure of the asn-bound guinea pig l-asparaginase 1 catalytic domain active site mutant t116a (see paper)
35% identity, 96% coverage: 8:343/350 of query aligns to 1:343/357 of 5dndD
5ot0A The thermostable l-asparaginase from thermococcus kodakarensis (see paper)
35% identity, 81% coverage: 66:349/350 of query aligns to 52:324/328 of 5ot0A
Sites not aligning to the query:
4q0mA Crystal structure of pyrococcus furiosus l-asparaginase (see paper)
32% identity, 81% coverage: 66:349/350 of query aligns to 51:324/327 of 4q0mA
Sites not aligning to the query:
Q8TZE8 L-asparaginase; EC 3.5.1.1 from Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) (see 2 papers)
32% identity, 81% coverage: 66:349/350 of query aligns to 50:323/326 of Q8TZE8
Sites not aligning to the query:
1zq1A Structure of gatde tRNA-dependent amidotransferase from pyrococcus abyssi (see paper)
29% identity, 81% coverage: 66:349/350 of query aligns to 143:425/437 of 1zq1A
Sites not aligning to the query:
4njeA Crystal structure of pyrococcus furiosus l-asparaginase with ligand (see paper)
41% identity, 38% coverage: 66:198/350 of query aligns to 50:181/182 of 4njeA
Sites not aligning to the query:
5b5uA Crystal structure of truncated pyrococcus furiosus l-asparaginase with peptide (see paper)
41% identity, 36% coverage: 66:190/350 of query aligns to 50:173/175 of 5b5uA
Sites not aligning to the query:
7c8qA Blasnase-t13a with d-asn (see paper)
28% identity, 92% coverage: 9:330/350 of query aligns to 2:309/321 of 7c8qA
8h4aB Blasnase-t13a/m57p
28% identity, 96% coverage: 9:343/350 of query aligns to 2:322/328 of 8h4aB
7cbuA Blasnase-t13a with l-asp (see paper)
29% identity, 92% coverage: 9:330/350 of query aligns to 2:306/318 of 7cbuA
7c8xA Blasnase-t13a with l-asn (see paper)
30% identity, 69% coverage: 88:330/350 of query aligns to 76:308/319 of 7c8xA
Sites not aligning to the query:
P38986 L-asparaginase 1; L-asparaginase I; L-asparagine amidohydrolase I; ASP I; EC 3.5.1.1 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
22% identity, 95% coverage: 11:342/350 of query aligns to 56:375/381 of P38986
1ho3A Crystal structure analysis of e. Coli l-asparaginase ii (y25f mutant) (see paper)
32% identity, 33% coverage: 76:189/350 of query aligns to 66:180/326 of 1ho3A
Sites not aligning to the query:
7r5qA Escherichia coli type ii asparaginase n24s mutant in complex with glu (see paper)
32% identity, 33% coverage: 76:189/350 of query aligns to 46:160/306 of 7r5qA
Sites not aligning to the query:
P00805 L-asparaginase 2; L-asparaginase II; L-ASNase II; L-asparagine amidohydrolase II; Colaspase; EC 3.5.1.1 from Escherichia coli (strain K12) (see 5 papers)
32% identity, 33% coverage: 76:189/350 of query aligns to 88:202/348 of P00805
Sites not aligning to the query:
>WP_086509657.1 NCBI__GCF_002151265.1:WP_086509657.1
MIAPPFADRPVLVLYTGGTLGMMPSAEGLVPAGDIETRLRNALDGLPPSRQSQLPEFVVH
TVASPIDSSAATPHDWQRLAATIADRIGQHAGIVVLHGTDTLAWSASSLAFQLQGLDRPV
VVTGAMHPLEAEGSDALANIELALRFAARPELQEIAVAFAGRLLRGARSSKTHSENDDAF
ASPNYPLLGEQVGDDVVLYPARCLETQQRGAPRFELPDYSPLAKGGVVRLALWPGIQAWQ
LEAWLGDDRVQGALLEVWGGGNIPPDPEVIGVLAKASGEGKLIAAISQCRWGGIAPGRYA
AGQGLIEAGVLSGDDMTPEAAITKLVHLLALPLDATERRRLFLTPLVGER
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory