SitesBLAST
Comparing WP_086509680.1 NCBI__GCF_002151265.1:WP_086509680.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6dktE Crystal structure of arginase from bacillus subtilis
28% identity, 86% coverage: 43:315/319 of query aligns to 4:262/268 of 6dktE
6dktA Crystal structure of arginase from bacillus subtilis
28% identity, 86% coverage: 43:315/319 of query aligns to 4:277/283 of 6dktA
4mynA Crystal structure of trypanosoma cruzi formiminoglutamase n114h variant with mn2+2 (see paper)
29% identity, 86% coverage: 44:317/319 of query aligns to 22:292/298 of 4mynA
- active site: H110 (= H126), D134 (= D156), H136 (= H158), D138 (= D160), S150 (= S170), D224 (= D248), D226 (= D250), E269 (= E293)
- binding manganese (ii) ion: H110 (= H126), D134 (= D156), D134 (= D156), H136 (= H158), D138 (= D160), D224 (= D248), D224 (= D248), D226 (= D250)
6nfpD 1.7 angstrom resolution crystal structure of arginase from bacillus subtilis subsp. Subtilis str. 168
28% identity, 86% coverage: 43:315/319 of query aligns to 7:283/289 of 6nfpD
6nfpA 1.7 angstrom resolution crystal structure of arginase from bacillus subtilis subsp. Subtilis str. 168
27% identity, 86% coverage: 43:315/319 of query aligns to 4:286/292 of 6nfpA
5cevA Arginase from bacillus caldevelox, l-lysine complex (see paper)
26% identity, 86% coverage: 43:315/319 of query aligns to 4:292/298 of 5cevA
- active site: H98 (= H126), D121 (= D156), H123 (= H158), D125 (= D160), H138 (vs. gap), D225 (= D248), D227 (= D250), E270 (= E293)
- binding guanidine: H251 (≠ E274), E255 (= E278)
- binding lysine: S134 (= S169), H138 (vs. gap), E270 (= E293)
- binding manganese (ii) ion: H98 (= H126), D121 (= D156), D121 (= D156), H123 (= H158), D125 (= D160), D225 (= D248), D225 (= D248), D227 (= D250)
4cevA Arginase from bacillus caldevelox, l-ornithine complex (see paper)
26% identity, 86% coverage: 43:315/319 of query aligns to 4:292/298 of 4cevA
- active site: H98 (= H126), D121 (= D156), H123 (= H158), D125 (= D160), H138 (vs. gap), D225 (= D248), D227 (= D250), E270 (= E293)
- binding guanidine: H251 (≠ E274), E255 (= E278)
- binding manganese (ii) ion: H98 (= H126), D121 (= D156), D121 (= D156), H123 (= H158), D125 (= D160), D225 (= D248), D225 (= D248), D227 (= D250)
- binding L-ornithine: H123 (= H158), D125 (= D160), S134 (= S169), H138 (vs. gap), D177 (≠ S199)
3cevA Arginase from bacillus caldevelox, complexed with l-arginine (see paper)
26% identity, 86% coverage: 43:315/319 of query aligns to 4:292/298 of 3cevA
- active site: H98 (= H126), D121 (= D156), H123 (= H158), D125 (= D160), H138 (vs. gap), D225 (= D248), D227 (= D250), E270 (= E293)
- binding arginine: H123 (= H158), D125 (= D160), S134 (= S169), H138 (vs. gap), D225 (= D248), H251 (≠ E274), E255 (= E278), E270 (= E293)
- binding manganese (ii) ion: H98 (= H126), D121 (= D156), D125 (= D160), D225 (= D248)
Sites not aligning to the query:
2cevB Arginase from bacillus caldevelox, native structure at ph 8.5 (see paper)
26% identity, 86% coverage: 43:315/319 of query aligns to 4:292/298 of 2cevB
- active site: H98 (= H126), D121 (= D156), H123 (= H158), D125 (= D160), H138 (vs. gap), D225 (= D248), D227 (= D250), E270 (= E293)
- binding guanidine: H251 (≠ E274), E255 (= E278)
- binding manganese (ii) ion: H98 (= H126), D121 (= D156), D121 (= D156), H123 (= H158), D125 (= D160), D225 (= D248), D225 (= D248), D227 (= D250)
1cevA Arginase from bacillus caldovelox, native structure at ph 5.6 (see paper)
26% identity, 86% coverage: 43:315/319 of query aligns to 5:293/299 of 1cevA
- active site: H99 (= H126), D122 (= D156), H124 (= H158), D126 (= D160), H139 (vs. gap), D226 (= D248), D228 (= D250), E271 (= E293)
- binding manganese (ii) ion: H99 (= H126), D122 (= D156), D122 (= D156), H124 (= H158), D126 (= D160), D226 (= D248), D226 (= D248), D228 (= D250)
P53608 Arginase; EC 3.5.3.1 from Bacillus caldovelox (see paper)
26% identity, 86% coverage: 43:315/319 of query aligns to 5:293/299 of P53608
6nbkA Crystal structure of arginase from bacillus cereus
27% identity, 86% coverage: 43:315/319 of query aligns to 4:283/289 of 6nbkA
2ef5A Crystal structure of the arginase from thermus thermophilus
30% identity, 85% coverage: 42:311/319 of query aligns to 3:263/273 of 2ef5A
- active site: H80 (= H126), D102 (= D156), H104 (= H158), D106 (= D160), H118 (vs. gap), D200 (= D248), D202 (= D250), E245 (= E293)
- binding lysine: P9 (≠ A48), D15 (≠ A54), M16 (≠ R55), S19 (≠ R67)
- binding manganese (ii) ion: H80 (= H126), D102 (= D156), D102 (= D156), H104 (= H158), D106 (= D160), D200 (= D248), D200 (= D248), D202 (= D250)
Q9I6K2 Guanidinopropionase; EC 3.5.3.17 from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see paper)
30% identity, 86% coverage: 42:315/319 of query aligns to 37:306/318 of Q9I6K2
- H126 (= H126) binding
- D148 (= D156) binding
- H150 (= H158) binding
- D152 (= D160) binding
- Y157 (vs. gap) mutation to M: Reduces substrate affinity 10-fold and catalytic efficiency 3-fold.
- D240 (= D248) binding
- D242 (= D250) binding
3niqA Crystal structure of pseudomonas aeruginosa guanidinopropionase (see paper)
30% identity, 86% coverage: 42:315/319 of query aligns to 34:303/315 of 3niqA
- active site: H123 (= H126), D145 (= D156), H147 (= H158), D149 (= D160), H162 (≠ S170), D237 (= D248), D239 (= D250), E281 (= E293)
- binding manganese (ii) ion: H123 (= H126), D145 (= D156), D145 (= D156), H147 (= H158), D149 (= D160), D237 (= D248), D237 (= D248), D239 (= D250)
3nipB Crystal structure of pseudomonas aeruginosa guanidinopropionase complexed with 1,6-diaminohexane (see paper)
30% identity, 86% coverage: 42:315/319 of query aligns to 35:304/316 of 3nipB
- active site: H124 (= H126), D146 (= D156), H148 (= H158), D150 (= D160), H163 (≠ S170), D238 (= D248), D240 (= D250), E282 (= E293)
- binding hexane-1,6-diamine: R49 (= R59), P244 (≠ A254), F246 (≠ E256), P248 (= P258), A292 (≠ R303), V296 (≠ A307)
7esrA Crystal structure of synechocystis sp pcc6803 guanidinium hydrolase (r32) (see paper)
25% identity, 85% coverage: 42:312/319 of query aligns to 77:347/378 of 7esrA
6q39A Complex of arginase 2 with example 49 (see paper)
26% identity, 82% coverage: 51:311/319 of query aligns to 8:291/306 of 6q39A
- active site: H97 (= H126), D120 (= D156), H122 (= H158), D124 (= D160), H137 (vs. gap), D228 (= D248), D230 (= D250), E273 (= E293)
- binding 3-[(3~{S},4~{R})-4-azanyl-4-carboxy-1-[[(2~{S})-piperidin-2-yl]methyl]pyrrolidin-3-yl]propyl-tris(oxidanyl)boranuide: H97 (= H126), D120 (= D156), H122 (= H158), D124 (= D160), N126 (≠ R162), S133 (= S169), H137 (vs. gap), D177 (≠ R207), D179 (≠ R209), D228 (= D248), T242 (≠ A262), E273 (= E293)
- binding manganese (ii) ion: H97 (= H126), D120 (= D156), D120 (= D156), H122 (= H158), D124 (= D160), D228 (= D248), D228 (= D248), D230 (= D250)
6q37A Complex of arginase 2 with example 23 (see paper)
26% identity, 82% coverage: 51:311/319 of query aligns to 8:291/306 of 6q37A
- active site: H97 (= H126), D120 (= D156), H122 (= H158), D124 (= D160), H137 (vs. gap), D228 (= D248), D230 (= D250), E273 (= E293)
- binding 3-[(3~{S},4~{R})-4-azanyl-4-carboxy-pyrrolidin-3-yl]propyl-tris(oxidanyl)boranuide: H97 (= H126), D120 (= D156), H122 (= H158), D124 (= D160), N126 (≠ R162), S133 (= S169), H137 (vs. gap), G138 (= G171), D179 (≠ R209), D228 (= D248)
- binding manganese (ii) ion: H97 (= H126), D120 (= D156), D120 (= D156), H122 (= H158), D124 (= D160), D228 (= D248), D228 (= D248), D230 (= D250)
4ixvA Crystal structure of human arginase-2 complexed with inhibitor 2d: {(5r)-5-amino-5-carboxy-5-[1-(4-chlorobenzyl)piperidin-4- yl]pentyl}(trihydroxy)borate(1-) (see paper)
26% identity, 82% coverage: 51:311/319 of query aligns to 8:291/306 of 4ixvA
- active site: H97 (= H126), D120 (= D156), H122 (= H158), D124 (= D160), H137 (vs. gap), D228 (= D248), D230 (= D250), E273 (= E293)
- binding manganese (ii) ion: H97 (= H126), D120 (= D156), D120 (= D156), H122 (= H158), D124 (= D160), D228 (= D248), D228 (= D248), D230 (= D250)
- binding {(5R)-5-amino-5-carboxy-5-[1-(4-chlorobenzyl)piperidin-4-yl]pentyl}(trihydroxy)borate(1-): D120 (= D156), H122 (= H158), D124 (= D160), S132 (≠ R168), S133 (= S169), H137 (vs. gap), G138 (= G171), D179 (≠ R209), D228 (= D248), E273 (= E293)
Query Sequence
>WP_086509680.1 NCBI__GCF_002151265.1:WP_086509680.1
MNSIYFDAIDMSPWAGREDPEPDSLRWHQVITPVRPDSAPGAALVGFASDAGVARNQGRV
GAAEGPRAIRRALAPLAWHRSAPVFDAGDVSCHGNDDLEAAQQRLADRIASLLARGHQPL
VLGGGHEVAFGSWSGLARHFEAEGEAHPRIGIINLDAHFDLRDPTHVRSSGTPFAQIAAE
CHARDWPFRYACLGVSRASNTRALFTRARELNVLVREDHEIDALRLDAIVRDLQRFMARC
DHLYLSIDLDVLPAAEAPGVSAPAARGVPLALIEPLLEAVRDSGKLRLADVAELNPSFDI
DGRTAKAAARLIHRLTLDT
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory