Comparing WP_086509681.1 NCBI__GCF_002151265.1:WP_086509681.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 14 hits to proteins with known functional sites (download)
A0KF84 Imidazolonepropionase; Imidazolone-5-propionate hydrolase; EC 3.5.2.7 from Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049) (see paper)
59% identity, 95% coverage: 23:406/406 of query aligns to 29:411/411 of A0KF84
2oofA The crystal structure of 4-imidazolone-5-propanoate amidohydrolase from environmental sample
59% identity, 94% coverage: 23:404/406 of query aligns to 24:401/403 of 2oofA
2q09A Crystal structure of imidazolonepropionase from environmental sample with bound inhibitor 3-(2,5-dioxo-imidazolidin-4-yl)-propionic acid (see paper)
59% identity, 94% coverage: 23:404/406 of query aligns to 23:400/402 of 2q09A
Q8U8Z6 Imidazolonepropionase; Imidazolone-5-propanoate hydrolase; Imidazolone-5-propionate hydrolase; EC 3.5.2.7 from Agrobacterium fabrum (strain C58 / ATCC 33970) (Agrobacterium tumefaciens (strain C58)) (see 2 papers)
56% identity, 87% coverage: 48:402/406 of query aligns to 66:415/419 of Q8U8Z6
2puzB Crystal structure of imidazolonepropionase from agrobacterium tumefaciens with bound product n-formimino-l-glutamate (see paper)
56% identity, 87% coverage: 48:402/406 of query aligns to 52:401/404 of 2puzB
2gokA Crystal structure of the imidazolonepropionase from agrobacterium tumefaciens at 1.87 a resolution (see paper)
56% identity, 87% coverage: 48:402/406 of query aligns to 52:401/404 of 2gokA
2g3fA Crystal structure of imidazolonepropionase complexed with imidazole-4- acetic acid sodium salt, a substrate homologue (see paper)
40% identity, 88% coverage: 46:403/406 of query aligns to 59:410/414 of 2g3fA
2bb0A Structure of imidazolonepropionase from bacillus subtilis (see paper)
40% identity, 88% coverage: 46:403/406 of query aligns to 58:409/413 of 2bb0A
P42084 Imidazolonepropionase; Imidazolone-5-propionate hydrolase; EC 3.5.2.7 from Bacillus subtilis (strain 168) (see paper)
40% identity, 88% coverage: 46:403/406 of query aligns to 60:411/421 of P42084
4tqtD Crystal structure of dihydropyrimidinase from brucella suis
36% identity, 16% coverage: 338:401/406 of query aligns to 354:416/481 of 4tqtD
Sites not aligning to the query:
3mkvF Crystal structure of amidohydrolase eaj56179 (see paper)
25% identity, 79% coverage: 58:378/406 of query aligns to 50:381/413 of 3mkvF
3mkvA Crystal structure of amidohydrolase eaj56179 (see paper)
25% identity, 79% coverage: 58:378/406 of query aligns to 51:382/414 of 3mkvA
4c5yA Crystal structure of a. Niger ochratoxinase (see paper)
25% identity, 94% coverage: 21:401/406 of query aligns to 17:415/436 of 4c5yA
A2R2V4 Ochratoxinase; OTase; Amidohydrolase 2; Amidase 2; Carboxypeptidase Am2; EC 3.4.17.- from Aspergillus niger (strain ATCC MYA-4892 / CBS 513.88 / FGSC A1513) (see 2 papers)
25% identity, 94% coverage: 21:401/406 of query aligns to 61:459/480 of A2R2V4
>WP_086509681.1 NCBI__GCF_002151265.1:WP_086509681.1
MSATTQPRLVWHDVTLFDGHDTLPEPMAVIVAGDTIERVVPMRELDPNETADCQPLGQGG
VMTPGLVDCHTHLVFGGSRADEFERRLEGASYEEIARRGGGILSTVRATREASEAQLFSL
ARPRLEALMREGVTTVEIKSGYGLSVADELKMLRVARHLGETLPVRVVTTLLGAHALPPE
YKDDSDGYIELVCREMIPAAAEQGLADAVDVFCEKIAFSVAQCERVFEAAEAHGLPIKAH
AEQLSNLGGSAMAARHGALSADHIEYLDEQGVNALREAGSVAVLLPGAFHTLRETQLPPI
AALREAGVPMAIATDANPGSSPLFMPTLMLNFACTLFRLTPREALAGMTAHGARALGLHT
RQLGRIVPGAPADLCLWDVESPAELAYAVQPGRLRQRMFSGEITHG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory