Comparing WP_086509706.1 NCBI__GCF_002151265.1:WP_086509706.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4wbtA Crystal structure of histidinol-phosphate aminotransferase from sinorhizobium meliloti in complex with pyridoxal-5'-phosphate
35% identity, 95% coverage: 17:365/369 of query aligns to 18:361/369 of 4wbtA
8bj3A Crystal structure of medicago truncatula histidinol-phosphate aminotransferase (hisn6) in complex with histidinol-phosphate (see paper)
28% identity, 93% coverage: 7:348/369 of query aligns to 7:343/360 of 8bj3A
4r5zA Crystal structure of rv3772 encoded aminotransferase (see paper)
31% identity, 85% coverage: 28:339/369 of query aligns to 18:327/353 of 4r5zA
4r2nA Crystal structure of rv3772 in complex with its substrate (see paper)
31% identity, 85% coverage: 28:339/369 of query aligns to 18:327/353 of 4r2nA
Sites not aligning to the query:
4r8dA Crystal structure of rv1600 encoded aminotransferase in complex with plp-mes from mycobacterium tuberculosis
29% identity, 82% coverage: 31:332/369 of query aligns to 28:332/369 of 4r8dA
1fg7A Crystal structure of l-histidinol phosphate aminotransferase with pyridoxal-5'-phosphate (see paper)
31% identity, 77% coverage: 63:347/369 of query aligns to 53:335/354 of 1fg7A
1fg3A Crystal structure of l-histidinol phosphate aminotransferase complexed with l-histidinol (see paper)
31% identity, 77% coverage: 63:347/369 of query aligns to 53:335/354 of 1fg3A
Sites not aligning to the query:
1geyA Crystal structure of histidinol-phosphate aminotransferase complexed with n-(5'-phosphopyridoxyl)-l-glutamate (see paper)
31% identity, 77% coverage: 63:347/369 of query aligns to 39:321/335 of 1geyA
Sites not aligning to the query:
1uu0A Histidinol-phosphate aminotransferase (hisc) from thermotoga maritima (apo-form) (see paper)
28% identity, 62% coverage: 81:308/369 of query aligns to 68:278/328 of 1uu0A
1uu1A Complex of histidinol-phosphate aminotransferase (hisc) from thermotoga maritima (apo-form) (see paper)
28% identity, 62% coverage: 81:308/369 of query aligns to 69:279/329 of 1uu1A
Sites not aligning to the query:
1h1cA Histidinol-phosphate aminotransferase (hisc) from thermotoga maritima (see paper)
28% identity, 62% coverage: 81:308/369 of query aligns to 69:279/329 of 1h1cA
Q9X0D0 Histidinol-phosphate aminotransferase; Imidazole acetol-phosphate transaminase; EC 2.6.1.9 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) (see paper)
29% identity, 60% coverage: 88:308/369 of query aligns to 81:284/335 of Q9X0D0
2f8jA Crystal structure of histidinol-phosphate aminotransferase (ec 2.6.1.9) (imidazole acetol-phosphate transferase) (tm1040) from thermotoga maritima at 2.40 a resolution
29% identity, 60% coverage: 88:308/369 of query aligns to 82:285/335 of 2f8jA
3cq5B Histidinol-phosphate aminotransferase from corynebacterium glutamicum in complex with pmp (see paper)
26% identity, 81% coverage: 34:332/369 of query aligns to 31:332/366 of 3cq5B
3cq6A Histidinol-phosphate aminotransferase from corynebacterium glutamicum holo-form (plp covalently bound ) (see paper)
26% identity, 81% coverage: 34:332/369 of query aligns to 29:330/364 of 3cq6A
Sites not aligning to the query:
3ly1D Crystal structure of putative histidinol-phosphate aminotransferase (yp_050345.1) from erwinia carotovora atroseptica scri1043 at 1.80 a resolution
26% identity, 67% coverage: 63:308/369 of query aligns to 48:295/354 of 3ly1D
7szpA Crystal structure of histidinol-phosphate aminotransferase from klebsiella pneumoniae subsp. Pneumoniae (strain hs11286)
30% identity, 72% coverage: 84:347/369 of query aligns to 74:335/353 of 7szpA
3b1eA Crystal structure of betac-s lyase from streptococcus anginosus in complex with l-serine: alpha-aminoacrylate form (see paper)
26% identity, 64% coverage: 79:313/369 of query aligns to 80:328/387 of 3b1eA
Sites not aligning to the query:
3b1dA Crystal structure of betac-s lyase from streptococcus anginosus in complex with l-serine: external aldimine form (see paper)
26% identity, 64% coverage: 79:313/369 of query aligns to 80:328/387 of 3b1dA
Sites not aligning to the query:
3b1cA Crystal structure of betac-s lyase from streptococcus anginosus: internal aldimine form (see paper)
26% identity, 64% coverage: 79:313/369 of query aligns to 80:328/387 of 3b1cA
>WP_086509706.1 NCBI__GCF_002151265.1:WP_086509706.1
MPRFPDHLKGSGPSNPFPGIKVLERRIGREIPHRLGSNEGLDMPHRALRERFGDAMTEHV
YCYGDAEALGVRQRLASLYGLPLEHTLVDAGADSLIALALRTVAEPGCTVVSASGTYPTF
GYFARGQNCHLVERPYREAPGLLTPDLEALLAAAQEHRARLVYVANPDNPSGHLHGDDEI
RRLRAELPEDCWLLLDEAYHDFRDDADSPFSREALPGVIRLRTLSKAHGLAGMRIGYAIA
EPETLAMMMKVRIHYAVSSLTQIIAETVLDRHTEVEAHIRAVKARRERLARHFRELGAEV
LPSATNFIALRFSSAELAGRLNQELLEAGRLIARPAHPDLGHVLRITAVEDALVPGRFDI
LERALASGA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory