Comparing WP_086509707.1 NCBI__GCF_002151265.1:WP_086509707.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
8j5qD Cryo-em structure of mycobacterium tuberculosis oppabcd in the pre- translocation state (see paper)
48% identity, 48% coverage: 272:531/540 of query aligns to 336:603/611 of 8j5qD
Sites not aligning to the query:
8j5tD Cryo-em structure of mycobacterium tuberculosis oppabcd in the catalytic intermediate state (see paper)
47% identity, 48% coverage: 272:531/540 of query aligns to 336:603/608 of 8j5tD
Sites not aligning to the query:
8j5sD Cryo-em structure of mycobacterium tuberculosis oppabcd in the pre- catalytic intermediate state (see paper)
47% identity, 48% coverage: 272:531/540 of query aligns to 336:603/608 of 8j5sD
Sites not aligning to the query:
P0AAH4 Putrescine export system ATP-binding protein SapD from Escherichia coli (strain K12) (see paper)
40% identity, 51% coverage: 6:280/540 of query aligns to 2:286/330 of P0AAH4
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
39% identity, 47% coverage: 278:529/540 of query aligns to 1:243/343 of P30750
Sites not aligning to the query:
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
38% identity, 47% coverage: 278:529/540 of query aligns to 2:244/344 of 6cvlD
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
38% identity, 47% coverage: 278:529/540 of query aligns to 2:244/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
38% identity, 47% coverage: 278:529/540 of query aligns to 2:244/344 of 3tuiC
4fwiB Crystal structure of the nucleotide-binding domain of a dipeptide abc transporter (see paper)
41% identity, 44% coverage: 26:261/540 of query aligns to 22:257/310 of 4fwiB
Sites not aligning to the query:
Q8RDH4 Dipeptide transport ATP-binding protein DppD; EC 7.4.2.9 from Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) (Thermoanaerobacter tengcongensis) (see paper)
41% identity, 44% coverage: 26:261/540 of query aligns to 23:258/326 of Q8RDH4
Sites not aligning to the query:
7z18I E. Coli c-p lyase bound to a phnk abc dimer and atp (see paper)
36% identity, 48% coverage: 6:264/540 of query aligns to 2:250/250 of 7z18I
7z15I E. Coli c-p lyase bound to a phnk/phnl dual abc dimer and adp + pi (see paper)
36% identity, 48% coverage: 6:264/540 of query aligns to 2:250/253 of 7z15I
7z16I E. Coli c-p lyase bound to phnk/phnl dual abc dimer with amppnp and phnk e171q mutation (see paper)
36% identity, 48% coverage: 6:264/540 of query aligns to 2:250/250 of 7z16I
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
37% identity, 47% coverage: 277:530/540 of query aligns to 1:239/241 of 4u00A
7ahhC Opua inhibited inward-facing, sbd docked (see paper)
37% identity, 41% coverage: 306:528/540 of query aligns to 44:264/382 of 7ahhC
Sites not aligning to the query:
7aheC Opua inhibited inward facing (see paper)
37% identity, 41% coverage: 306:528/540 of query aligns to 44:264/382 of 7aheC
Sites not aligning to the query:
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
35% identity, 46% coverage: 284:530/540 of query aligns to 4:239/240 of 4ymuJ
7ahdC Opua (e190q) occluded (see paper)
37% identity, 41% coverage: 306:524/540 of query aligns to 44:260/260 of 7ahdC
Sites not aligning to the query:
3c4jA Abc protein artp in complex with atp-gamma-s
35% identity, 47% coverage: 278:530/540 of query aligns to 3:241/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
35% identity, 47% coverage: 278:530/540 of query aligns to 3:241/242 of 3c41J
>WP_086509707.1 NCBI__GCF_002151265.1:WP_086509707.1
MNDNAPVLSIRGLTLALPKGADRDYAVEEVSYDVARGEIMCVVGESGSGKSMAANAVMGL
LPKGVRPTAGEVLFDGQNLLALNEKQHRKLRGLRIGMIFQEPMTALNPLMRVGAQIAEVF
EAHGKYSSRERQEKALALLEEVGIPEPDKAIRAYPFQLSGGQRQRVMIAMALALEPELLI
ADEPTTALDVTTQAQILELIRDLQQRRGMAVMFITHDFGVVAEVATRVCVMRYGRVVELG
TAREVLENPRHEYTRALLEAIPSNIIPEAVAQQRPAPLLEVRNLNKVFRSRGGLFKPARE
VRALDDVSFTLAPGETVGIVGESGSGKSTLGRCVVRLERPDSGSLSLSGTDFSALKGDEL
RRERRRVQMIFQDPYASLNPRHRVGYAIAQGPMANGVPRRQAMQQAEELLELVGLGAVAV
DRYPHEFSGGQRQRIGIARALALNPELIVADEAVSALDVSIQAQVLELLEELKQKLSLSL
LFITHDLRVAAQICDSIIVMQHGRIVEQGTAQEVFLRPREAYTKQLLDAIPGRAHEAAMA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory