SitesBLAST
Comparing WP_086509740.1 NCBI__GCF_002151265.1:WP_086509740.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6lpxA Crystal structure of human d-2-hydroxyglutarate dehydrogenase in complex with 2-oxoglutarate (2-og) (see paper)
38% identity, 99% coverage: 5:461/463 of query aligns to 17:466/466 of 6lpxA
- binding 2-oxoglutaric acid: R333 (= R326), T337 (≠ E330), K348 (≠ T341), Y379 (≠ F374), H381 (= H376), H388 (= H383), H423 (= H418)
- binding flavin-adenine dinucleotide: W39 (= W30), P75 (≠ T66), Q76 (≠ H67), G77 (= G68), G78 (= G69), N79 (≠ L70), T80 (= T71), G81 (= G72), M82 (≠ L73), G85 (= G76), S86 (≠ G77), L139 (= L130), G140 (= G131), A141 (= A132), C145 (= C136), G149 (= G140), N150 (= N141), A152 (= A143), T153 (= T144), G157 (= G148), G207 (= G198), I212 (≠ V203), E422 (= E417), N459 (= N454)
- binding zinc ion: H381 (= H376), H388 (= H383), E422 (= E417)
6lpuA Crystal structure of human d-2-hydroxyglutarate dehydrogenase in complex with l-2-hydroxyglutarate (l-2-hg) (see paper)
38% identity, 99% coverage: 5:461/463 of query aligns to 17:466/466 of 6lpuA
- binding flavin-adenine dinucleotide: W39 (= W30), P75 (≠ T66), G77 (= G68), G78 (= G69), N79 (≠ L70), T80 (= T71), G81 (= G72), G85 (= G76), S86 (≠ G77), L139 (= L130), G140 (= G131), A141 (= A132), C145 (= C136), H146 (≠ T137), G148 (= G139), G149 (= G140), N150 (= N141), A152 (= A143), T153 (= T144), A155 (= A146), E206 (= E197), G207 (= G198), I211 (= I202), I212 (≠ V203), E422 (= E417), N459 (= N454)
- binding (2s)-2-hydroxypentanedioic acid: R333 (= R326), T337 (≠ E330), K348 (≠ T341), Y379 (≠ F374), H381 (= H376), H388 (= H383), H423 (= H418)
- binding zinc ion: H381 (= H376), H388 (= H383), E422 (= E417)
6lpqA Crystal structure of human d-2-hydroxyglutarate dehydrogenase in complex with d-malate (d-mal) (see paper)
38% identity, 99% coverage: 5:461/463 of query aligns to 17:466/466 of 6lpqA
- binding flavin-adenine dinucleotide: W39 (= W30), P75 (≠ T66), G77 (= G68), G78 (= G69), N79 (≠ L70), T80 (= T71), G81 (= G72), G85 (= G76), S86 (≠ G77), L139 (= L130), G140 (= G131), A141 (= A132), C145 (= C136), H146 (≠ T137), G149 (= G140), N150 (= N141), A152 (= A143), T153 (= T144), A155 (= A146), G157 (= G148), E206 (= E197), G207 (= G198), I211 (= I202), I212 (≠ V203), E422 (= E417), N459 (= N454)
- binding d-malate: M82 (≠ L73), R333 (= R326), T337 (≠ E330), K348 (≠ T341), Y379 (≠ F374), H381 (= H376), H388 (= H383), E422 (= E417), H423 (= H418)
- binding zinc ion: H381 (= H376), H388 (= H383), E422 (= E417)
6lppA Crystal structure of human d-2-hydroxyglutarate dehydrogenase in complex with d-2-hydroxyglutarate (d-2-hg) (see paper)
38% identity, 99% coverage: 5:461/463 of query aligns to 17:466/466 of 6lppA
- binding (2R)-2-hydroxypentanedioic acid: R333 (= R326), T337 (≠ E330), K348 (≠ T341), Y379 (≠ F374), H381 (= H376), H388 (= H383), N390 (≠ S385), H423 (= H418)
- binding flavin-adenine dinucleotide: W39 (= W30), P75 (≠ T66), G77 (= G68), G78 (= G69), N79 (≠ L70), T80 (= T71), G81 (= G72), M82 (≠ L73), G85 (= G76), S86 (≠ G77), L139 (= L130), G140 (= G131), A141 (= A132), C145 (= C136), G149 (= G140), N150 (= N141), A152 (= A143), T153 (= T144), A155 (= A146), G157 (= G148), G207 (= G198), I212 (≠ V203), E422 (= E417), H423 (= H418)
- binding zinc ion: H381 (= H376), H388 (= H383), E422 (= E417)
6lpnB Crystal structure of human d-2-hydroxyglutarate dehydrogenase in apo form (see paper)
38% identity, 99% coverage: 5:461/463 of query aligns to 18:467/467 of 6lpnB
- binding flavin-adenine dinucleotide: W40 (= W30), P76 (≠ T66), G78 (= G68), G79 (= G69), N80 (≠ L70), T81 (= T71), G82 (= G72), M83 (≠ L73), G86 (= G76), S87 (≠ G77), L140 (= L130), A142 (= A132), C146 (= C136), H147 (≠ T137), G150 (= G140), N151 (= N141), A153 (= A143), T154 (= T144), G208 (= G198), I212 (= I202), I213 (≠ V203), E423 (= E417), N460 (= N454)
Q8N465 D-2-hydroxyglutarate dehydrogenase, mitochondrial; EC 1.1.99.39 from Homo sapiens (Human) (see 7 papers)
38% identity, 99% coverage: 5:462/463 of query aligns to 70:520/521 of Q8N465
- S109 (≠ T47) to W: in D2HGA1; uncertain significance; significant loss of catalytic activity; dbSNP:rs142050154
- N127 (≠ V65) to K: in D2HGA1; uncertain significance; complete loss of catalytic activity; dbSNP:rs762857195
- G131 (= G69) to V: in D2HGA1; uncertain significance; complete loss of catalytic activity
- I147 (≠ A85) to S: in D2HGA1; uncertain significance; severe phenotype; almost complete loss of catalytic activity; dbSNP:rs121434361
- M153 (= M91) to T: in D2HGA1; uncertain significance; significant loss of catalytic activity; to V: in D2HGA1; uncertain significance; significant loss of catalytic activity; dbSNP:rs1432270139
- C172 (≠ I110) to Y: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs773735172
- P189 (≠ A127) to L: in D2HGA1; uncertain significance; almost complete loss of catalytic activity; dbSNP:rs587783517
- A205 (= A143) to V: in D2HGA1; uncertain significance; almost complete loss of catalytic activity; dbSNP:rs750889931
- A231 (= A169) to V: in D2HGA1; uncertain significance; significant loss of catalytic activity
- G233 (= G171) to S: in D2HGA1; uncertain significance; no effect on catalytic activity; dbSNP:rs374535734
- D375 (≠ S315) to Y: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs267606759
- R386 (= R326) binding ; binding ; binding ; mutation to A: Loss of catalytic activity.
- T390 (≠ E330) binding ; binding ; mutation to A: Significantly reduced catalytic activity.
- V399 (≠ L339) to M: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs746519212
- K401 (≠ T341) binding ; binding ; mutation to A: Loss of catalytic activity.
- R419 (≠ E359) to H: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs199908032
- A426 (≠ G369) to T: in D2HGA1; uncertain significance; no effect on catalytic activity; dbSNP:rs146578303
- H434 (= H376) binding ; mutation to A: Loss of catalytic activity.
- G436 (= G378) to V: slight reduction in catalytic activity
- N439 (= N381) to D: in D2HGA1; uncertain significance; mild phenotype; moderate reduction in catalytic activity; dbSNP:rs121434362
- H441 (= H383) binding ; mutation to A: Loss of catalytic activity.
- N443 (≠ S385) binding ; mutation to A: Significantly reduced catalytic activity.
- V444 (= V386) to A: in D2HGA1; uncertain significance; severe phenotype; significant reduction in catalytic activity; dbSNP:rs121434360
- A446 (≠ V388) to V: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs746956176
- E475 (= E417) binding ; mutation to A: Loss of catalytic activity.
- H476 (= H418) binding ; binding ; binding ; mutation to A: Loss of catalytic activity.
- G477 (= G419) to R: in D2HGA1; uncertain significance; almost complete loss of catalytic activity; dbSNP:rs1453924640
Sites not aligning to the query:
- 15 R → G: in dbSNP:rs4675887
- 169:521 natural variant: Missing (in D2HGA1; uncertain significance)
- 400:521 natural variant: Missing (in D2HGA1; uncertain significance; complete loss of catalytic activity)
3pm9A Crystal structure of a putative dehydrogenase (rpa1076) from rhodopseudomonas palustris cga009 at 2.57 a resolution
39% identity, 98% coverage: 4:459/463 of query aligns to 6:465/465 of 3pm9A
- active site: A149 (= A146), L159 (≠ M156)
- binding flavin-adenine dinucleotide: P69 (≠ T66), Q70 (≠ H67), G71 (= G68), G72 (= G69), N73 (≠ L70), T74 (= T71), G75 (= G72), L76 (= L73), G79 (= G76), Q80 (≠ G77), L91 (= L88), L133 (= L130), G134 (= G131), A135 (= A132), C139 (= C136), T140 (= T137), G142 (= G139), G143 (= G140), S146 (≠ A143), T147 (= T144), A149 (= A146), G150 (= G147), E200 (= E197), G201 (= G198), I205 (= I202), I206 (≠ V203), E423 (= E417)
P39976 D-2-hydroxyglutarate--pyruvate transhydrogenase DLD3; D-2HG--pyruvate transhydrogenase DLD3; (R)-2-hydroxyglutarate--pyruvate transhydrogenase; D-lactate dehydrogenase [cytochrome] 3; D-lactate ferricytochrome C oxidoreductase; D-LCR; EC 1.1.99.40; EC 1.1.2.4 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
33% identity, 95% coverage: 21:459/463 of query aligns to 51:496/496 of P39976
Sites not aligning to the query:
- 17 modified: Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)
7qh2C Cryo-em structure of ldh-etfab complex from acetobacterium woodii (see paper)
30% identity, 90% coverage: 41:458/463 of query aligns to 48:463/467 of 7qh2C
- binding flavin-adenine dinucleotide: V73 (≠ T66), G75 (= G68), S76 (≠ G69), G77 (≠ L70), T78 (= T71), G79 (= G72), L80 (= L73), A83 (≠ E78), C84 (≠ A79), P137 (≠ L130), G138 (= G131), E139 (≠ A132), A142 (≠ C136), T143 (= T137), G146 (= G140), N147 (= N141), S149 (≠ A143), T150 (= T144), A152 (= A146), G153 (= G147), E203 (= E197), G204 (= G198), I209 (≠ V203), E422 (= E417), H423 (= H418)
- binding fe (iii) ion: H377 (= H376), H384 (= H383), E422 (= E417)
8jduA Crystal structure of mldhd in complex with 2-ketovaleric acid (see paper)
30% identity, 99% coverage: 2:459/463 of query aligns to 3:455/455 of 8jduA
- binding 2-oxopentanoic acid: R318 (= R326), W322 (≠ E330), H369 (= H376), H376 (= H383), H414 (= H418)
- binding flavin-adenine dinucleotide: P68 (≠ T66), G70 (= G68), T71 (≠ G69), G72 (≠ L70), T73 (= T71), G74 (= G72), G78 (= G76), V79 (≠ G77), L90 (= L88), P132 (≠ L130), G133 (= G131), A134 (= A132), G140 (= G140), M141 (≠ N141), A143 (= A143), T144 (= T144), A146 (= A146), S147 (≠ G147), E200 (= E197), G201 (= G198), I206 (≠ V203), W322 (≠ E330), E413 (= E417), N450 (= N454)
- binding manganese (ii) ion: H369 (= H376), H376 (= H383), E413 (= E417)
8jdvA Crystal structure of mldhd in complex with 2-ketohexanoic acid (see paper)
31% identity, 99% coverage: 2:459/463 of query aligns to 3:454/454 of 8jdvA
- binding 2-Ketohexanoic acid: V75 (≠ L73), R317 (= R326), W321 (≠ E330), H368 (= H376), H375 (= H383), H413 (= H418)
- binding flavin-adenine dinucleotide: P68 (≠ T66), G70 (= G68), T71 (≠ G69), G72 (≠ L70), T73 (= T71), G74 (= G72), G78 (= G76), V79 (≠ G77), L90 (= L88), P132 (≠ L130), G133 (= G131), A134 (= A132), G140 (= G140), M141 (≠ N141), A143 (= A143), T144 (= T144), A146 (= A146), S147 (≠ G147), E200 (= E197), G201 (= G198), I206 (≠ V203), W321 (≠ E330), Y322 (≠ G331), E412 (= E417), H413 (= H418), N449 (= N454)
- binding manganese (ii) ion: H368 (= H376), H375 (= H383), E412 (= E417)
8jdsA Crystal structure of mldhd in complex with pyruvate (see paper)
30% identity, 99% coverage: 2:459/463 of query aligns to 3:456/456 of 8jdsA
- binding flavin-adenine dinucleotide: E32 (≠ M31), P68 (≠ T66), G70 (= G68), T71 (≠ G69), G72 (≠ L70), T73 (= T71), G74 (= G72), G78 (= G76), V79 (≠ G77), L90 (= L88), P132 (≠ L130), G133 (= G131), A134 (= A132), G140 (= G140), M141 (≠ N141), A143 (= A143), T144 (= T144), A146 (= A146), S147 (≠ G147), E200 (= E197), G201 (= G198), I206 (≠ V203), W323 (≠ E330), E414 (= E417), H415 (= H418), N451 (= N454)
- binding manganese (ii) ion: H370 (= H376), H377 (= H383), E414 (= E417)
- binding pyruvic acid: R319 (= R326), H370 (= H376), H377 (= H383), H415 (= H418)
8jdeA Crystal structure of mldhd in complex with d-lactate (see paper)
30% identity, 99% coverage: 2:459/463 of query aligns to 3:455/455 of 8jdeA
- binding flavin-adenine dinucleotide: P68 (≠ T66), G70 (= G68), T71 (≠ G69), G72 (≠ L70), T73 (= T71), G74 (= G72), G78 (= G76), V79 (≠ G77), L90 (= L88), P132 (≠ L130), G133 (= G131), A134 (= A132), G140 (= G140), M141 (≠ N141), A143 (= A143), T144 (= T144), A146 (= A146), S147 (≠ G147), E200 (= E197), G201 (= G198), I206 (≠ V203), W322 (≠ E330), E413 (= E417), H414 (= H418), N450 (= N454)
- binding lactic acid: R318 (= R326), H369 (= H376), H376 (= H383), H414 (= H418)
- binding manganese (ii) ion: H369 (= H376), H376 (= H383), E413 (= E417)
8jdxA Crystal structure of mldhd in complex with 2-ketoisovaleric acid (see paper)
30% identity, 99% coverage: 2:459/463 of query aligns to 3:455/455 of 8jdxA
- binding flavin-adenine dinucleotide: E32 (≠ M31), P68 (≠ T66), G70 (= G68), T71 (≠ G69), G72 (≠ L70), T73 (= T71), G74 (= G72), G78 (= G76), V79 (≠ G77), L90 (= L88), P132 (≠ L130), G133 (= G131), A134 (= A132), G140 (= G140), M141 (≠ N141), A143 (= A143), T144 (= T144), A146 (= A146), S147 (≠ G147), E200 (= E197), G201 (= G198), I206 (≠ V203), W322 (≠ E330), E413 (= E417), H414 (= H418), N450 (= N454)
- binding 3-methyl-2-oxobutanoic acid: R318 (= R326), H369 (= H376), H376 (= H383), H414 (= H418)
- binding manganese (ii) ion: H369 (= H376), H376 (= H383), E413 (= E417)
8jdtA Crystal structure of mldhd in complex with 2-ketobutanoic acid (see paper)
30% identity, 99% coverage: 2:459/463 of query aligns to 3:455/455 of 8jdtA
- binding 2-ketobutyric acid: R318 (= R326), H369 (= H376), H376 (= H383), H414 (= H418)
- binding flavin-adenine dinucleotide: P68 (≠ T66), G70 (= G68), T71 (≠ G69), G72 (≠ L70), T73 (= T71), G74 (= G72), G78 (= G76), V79 (≠ G77), L90 (= L88), P132 (≠ L130), G133 (= G131), A134 (= A132), G140 (= G140), M141 (≠ N141), A143 (= A143), T144 (= T144), A146 (= A146), S147 (≠ G147), E200 (= E197), G201 (= G198), I206 (≠ V203), W322 (≠ E330), E413 (= E417), H414 (= H418), N450 (= N454)
- binding manganese (ii) ion: H369 (= H376), H376 (= H383), E413 (= E417)
8jdpA Crystal structure of h405a mldhd in complex with d-2-hydroxyisovaleric acid (see paper)
30% identity, 99% coverage: 2:459/463 of query aligns to 3:455/455 of 8jdpA
- binding flavin-adenine dinucleotide: P68 (≠ T66), G70 (= G68), T71 (≠ G69), G72 (≠ L70), T73 (= T71), G74 (= G72), G78 (= G76), V79 (≠ G77), L90 (= L88), P132 (≠ L130), G133 (= G131), A134 (= A132), G140 (= G140), M141 (≠ N141), A143 (= A143), T144 (= T144), A146 (= A146), S147 (≠ G147), E200 (= E197), G201 (= G198), I206 (≠ V203), H369 (= H376), E413 (= E417), N450 (= N454)
- binding deaminohydroxyvaline: R319 (= R326), H414 (= H418)
8jdrA Crystal structure of h405a mldhd in complex with d-2-hydroxy-3-methyl- valeric acid (see paper)
30% identity, 99% coverage: 2:459/463 of query aligns to 3:456/456 of 8jdrA
- binding flavin-adenine dinucleotide: P68 (≠ T66), G70 (= G68), T71 (≠ G69), G72 (≠ L70), T73 (= T71), G74 (= G72), G78 (= G76), V79 (≠ G77), L90 (= L88), P132 (≠ L130), G133 (= G131), A134 (= A132), G140 (= G140), M141 (≠ N141), A143 (= A143), T144 (= T144), A146 (= A146), S147 (≠ G147), E200 (= E197), G201 (= G198), I206 (≠ V203), Y324 (≠ G331), H370 (= H376), E414 (= E417), N451 (= N454)
- binding (2R,3S)-3-methyl-2-oxidanyl-pentanoic acid: R319 (= R326), W323 (≠ E330), H415 (= H418)
8jdqA Crystal structure of h405a mldhd in complex with d-2-hydroxyisocaproic acid (see paper)
30% identity, 99% coverage: 2:459/463 of query aligns to 3:456/456 of 8jdqA
- binding (2R)-2-hydroxy-4-methylpentanoic acid: R319 (= R326), W323 (≠ E330), H370 (= H376), H415 (= H418)
- binding flavin-adenine dinucleotide: P68 (≠ T66), G70 (= G68), T71 (≠ G69), G72 (≠ L70), T73 (= T71), G74 (= G72), G78 (= G76), V79 (≠ G77), L90 (= L88), P132 (≠ L130), G133 (= G131), A134 (= A132), G140 (= G140), M141 (≠ N141), A143 (= A143), T144 (= T144), A146 (= A146), S147 (≠ G147), E200 (= E197), G201 (= G198), I206 (≠ V203), H370 (= H376), E414 (= E417), N451 (= N454)
8jdoA Crystal structure of h405a mldhd in complex with d-2-hydroxyhexanoic acid (see paper)
30% identity, 99% coverage: 2:459/463 of query aligns to 3:456/456 of 8jdoA
- binding (2R)-2-hydroxyhexanoic acid: R319 (= R326), W323 (≠ E330), H415 (= H418)
- binding flavin-adenine dinucleotide: P68 (≠ T66), G70 (= G68), T71 (≠ G69), G72 (≠ L70), T73 (= T71), G74 (= G72), G78 (= G76), V79 (≠ G77), L90 (= L88), P132 (≠ L130), G133 (= G131), A134 (= A132), G140 (= G140), M141 (≠ N141), A143 (= A143), T144 (= T144), A146 (= A146), S147 (≠ G147), E200 (= E197), G201 (= G198), I206 (≠ V203), Y324 (≠ G331), H370 (= H376), E414 (= E417), N451 (= N454)
8jdnA Crystal structure of h405a mldhd in complex with d-2-hydroxyvaleric acid (see paper)
30% identity, 99% coverage: 2:459/463 of query aligns to 3:456/456 of 8jdnA
- binding flavin-adenine dinucleotide: P68 (≠ T66), G70 (= G68), T71 (≠ G69), G72 (≠ L70), T73 (= T71), G74 (= G72), G78 (= G76), V79 (≠ G77), L90 (= L88), P132 (≠ L130), G133 (= G131), A134 (= A132), G140 (= G140), M141 (≠ N141), A143 (= A143), T144 (= T144), A146 (= A146), S147 (≠ G147), E200 (= E197), G201 (= G198), I206 (≠ V203), H370 (= H376), E414 (= E417), N451 (= N454)
- binding (2R)-2-oxidanylpentanoic acid: R319 (= R326), W323 (≠ E330), H415 (= H418)
Query Sequence
>WP_086509740.1 NCBI__GCF_002151265.1:WP_086509740.1
MQSLLERIVAIVGEGNVLTGDDVAQRRVDWMSGASCRAGAIVRPADTDELARVMRLCHAV
AQPVVTHGGLTGLVHGGEASPDELAISLERMTAIEAIDPIGGSMTVQAGIALQTVQEAAA
EHDLQFALDLGARGSCTIGGNIATNAGGVRVIRYGMMRQQVLGLEAVLADGSVVSSMNRM
LKNNAGYDLKQLFIGSEGTLGIVTRAVLRLQPRMTSERTALVACPDFDGVTGLLRHLGRT
LGGSLGTFEVMWRNHYALLTEESGRNTPPLPARWPFYAIVESLGSDDAANVAQFSAALES
ALEAGLIEDAVLAQSDAQRQGIWDIREDIEGLIDNLSPLFTFDVSLPIPDMADYADALER
RIGERWPEGRMVIFGHLGDGNLHVSVGVGSGDPQTRRDVEQIVYGPLAELGGSISAEHGI
GLEKRDYLPLSRTPGEIALMRTLKQALDPKGLLNRHKILAAEE
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory