Comparing WP_086509763.1 NCBI__GCF_002151265.1:WP_086509763.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4pzeA Crystal structure of (s)-3-hydroxybutyryl-coa dehydrogenase paah1 in complex with acetoacetyl-coa (see paper)
38% identity, 55% coverage: 10:290/511 of query aligns to 2:281/283 of 4pzeA
4pzdA Crystal structure of (s)-3-hydroxybutyryl-coa dehydrogenase paah1 in complex with NAD+ (see paper)
38% identity, 55% coverage: 10:290/511 of query aligns to 2:281/283 of 4pzdA
6aa8E Crystal structure of (s)-3-hydroxybutyryl-coenzymea dehydrogenase from clostridium acetobutylicum complexed with NAD+ (see paper)
37% identity, 55% coverage: 11:290/511 of query aligns to 1:279/281 of 6aa8E
4kugA Crystal structure of 3-hydroxybutylryl-coa dehydrogenase with NAD from clostridium butyricum
37% identity, 55% coverage: 10:290/511 of query aligns to 1:280/282 of 4kugA
4kuhA Crystal structure of 3-hydroxybutylryl-coa dehydrogenase with acetoacetyl-coa from clostridium butyricum
37% identity, 55% coverage: 10:290/511 of query aligns to 1:280/280 of 4kuhA
1f0yA L-3-hydroxyacyl-coa dehydrogenase complexed with acetoacetyl-coa and NAD+ (see paper)
36% identity, 55% coverage: 11:290/511 of query aligns to 5:290/291 of 1f0yA
1f17A L-3-hydroxyacyl-coa dehydrogenase complexed with nadh (see paper)
36% identity, 55% coverage: 11:290/511 of query aligns to 5:290/293 of 1f17A
1f12A L-3-hydroxyacyl-coa dehydrogenase complexed with 3-hydroxybutyryl-coa (see paper)
36% identity, 55% coverage: 11:290/511 of query aligns to 5:290/293 of 1f12A
P00348 Hydroxyacyl-coenzyme A dehydrogenase, mitochondrial; HCDH; L-3-hydroxyacyl CoA dehydrogenase; Medium and short-chain L-3-hydroxyacyl-coenzyme A dehydrogenase; Short-chain 3-hydroxyacyl-CoA dehydrogenase; EC 1.1.1.35 from Sus scrofa (Pig) (see paper)
35% identity, 55% coverage: 11:290/511 of query aligns to 28:313/314 of P00348
Q16836 Hydroxyacyl-coenzyme A dehydrogenase, mitochondrial; HCDH; Medium and short-chain L-3-hydroxyacyl-coenzyme A dehydrogenase; Short-chain 3-hydroxyacyl-CoA dehydrogenase; EC 1.1.1.35 from Homo sapiens (Human) (see 7 papers)
36% identity, 55% coverage: 11:290/511 of query aligns to 28:313/314 of Q16836
P9WNP7 3-hydroxybutyryl-CoA dehydrogenase; Beta-hydroxybutyryl-CoA dehydrogenase; BHBD; EC 1.1.1.157 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
34% identity, 55% coverage: 10:290/511 of query aligns to 5:286/286 of P9WNP7
P40939 Trifunctional enzyme subunit alpha, mitochondrial; 78 kDa gastrin-binding protein; Monolysocardiolipin acyltransferase; TP-alpha; EC 2.3.1.-; EC 4.2.1.17; EC 1.1.1.211 from Homo sapiens (Human) (see 5 papers)
34% identity, 55% coverage: 11:293/511 of query aligns to 362:642/763 of P40939
Sites not aligning to the query:
8oqsB Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-83
30% identity, 57% coverage: 2:294/511 of query aligns to 332:626/735 of 8oqsB
Sites not aligning to the query:
4b3iA Crystal structure of mycobacterium tuberculosis fatty acid beta-oxidation complex with coenzymea bound at the hydratase active sites (see paper)
30% identity, 57% coverage: 2:294/511 of query aligns to 328:622/731 of 4b3iA
Sites not aligning to the query:
8oqoA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-49
30% identity, 57% coverage: 2:294/511 of query aligns to 325:619/727 of 8oqoA
Sites not aligning to the query:
8oqvA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-109
30% identity, 57% coverage: 2:294/511 of query aligns to 324:618/726 of 8oqvA
Sites not aligning to the query:
8pf8A Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-72
30% identity, 57% coverage: 2:294/511 of query aligns to 326:620/729 of 8pf8A
Sites not aligning to the query:
8oquA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-92
30% identity, 57% coverage: 2:294/511 of query aligns to 327:621/730 of 8oquA
Sites not aligning to the query:
8oqtA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-91
30% identity, 57% coverage: 2:294/511 of query aligns to 326:620/729 of 8oqtA
Sites not aligning to the query:
8oqnA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-53
30% identity, 57% coverage: 2:294/511 of query aligns to 326:620/729 of 8oqnA
Sites not aligning to the query:
>WP_086509763.1 NCBI__GCF_002151265.1:WP_086509763.1
MPNATATPPFKTLGIVGTGAMGRGIAQIAAQAGLTVLLHDLREGAVTEAREFVGGMWQRA
VDKQRLSEAEAERYRANLKEAATLGELAGCDIVVEAIVEKLEAKQALFQQLEEILDDQAV
LATNTSSLSVTAIASSCRLPQRVIGFHFFNPVPLMKIVEVIPGLRTASDVADRVEALGQA
MGHFTARTTDTPGFLVNHAGRAFGTEALRILGERVTDHVTIDRILVDQGGFRMGPFALLD
LTGLDVSHAVMESIYHQYYEEPRFRPSPLTRQRLTAGLLGRKTGEGFYRYVEGKPQVPDE
TPPPPVEPRPVWIGAEDDEARRQLIGLVTAAGWPLENAEESHETPTPDALCLLAPLGEDA
TSCALRLGLPAERCVAVDLLAGLERRRSLMVTPATRAAYRDAAAALFAHDGTPVSVLDDS
TGFVLQRVVACIVNVGCEIAQQGVAAPQTVDRAVELGLGYPHGPLAMGDHYGSRRILTIL
DNMLAATGDPRYRASPWLRRRATLDMPLTAV
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory