SitesBLAST
Comparing WP_086509768.1 NCBI__GCF_002151265.1:WP_086509768.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
8sgsA Human liver mitochondrial short-chain specific acyl-coa dehydrogenase (see paper)
30% identity, 85% coverage: 31:337/363 of query aligns to 37:353/381 of 8sgsA
- binding coenzyme a: S131 (≠ Y123), A133 (= A125), N177 (≠ D165), F231 (≠ S214), M235 (≠ E218), L238 (= L221), I312 (≠ D296)
- binding flavin-adenine dinucleotide: F122 (≠ L114), L124 (≠ W116), S125 (≠ Q117), G130 (≠ R122), S131 (≠ Y123), W155 (≠ V147), T157 (≠ L149), R267 (= R250), F270 (= F253), L274 (= L257), L277 (≠ F260), Q335 (= Q319), I336 (≠ L320), G338 (= G322), G339 (≠ A323)
Sites not aligning to the query:
7y0aC Crystal structure of human short-chain acyl-coa dehydrogenase
30% identity, 85% coverage: 31:337/363 of query aligns to 43:359/387 of 7y0aC
- binding flavin-adenine dinucleotide: F128 (≠ L114), L130 (≠ W116), S131 (≠ Q117), G136 (≠ R122), S137 (≠ Y123), W161 (≠ V147), T163 (≠ L149), T214 (≠ A193), R273 (= R250), F276 (= F253), L280 (= L257), L283 (≠ F260), V285 (= V262), Q341 (= Q319), I342 (≠ L320), G345 (≠ A323)
Sites not aligning to the query:
1jqiA Crystal structure of rat short chain acyl-coa dehydrogenase complexed with acetoacetyl-coa (see paper)
30% identity, 85% coverage: 31:337/363 of query aligns to 40:356/384 of 1jqiA
- binding acetoacetyl-coenzyme a: L95 (≠ P77), F125 (≠ L114), S134 (≠ Y123), F234 (≠ S214), M238 (≠ E218), Q239 (≠ A219), L241 (= L221), D242 (≠ A222), R245 (= R225)
- binding flavin-adenine dinucleotide: F125 (≠ L114), L127 (≠ W116), S128 (≠ Q117), G133 (≠ R122), S134 (≠ Y123), W158 (≠ V147), T160 (≠ L149), R270 (= R250), F273 (= F253), L280 (≠ F260), Q338 (= Q319), I339 (≠ L320), G342 (≠ A323)
Sites not aligning to the query:
7y0bA Crystal structure of human short-chain acyl-coa dehydrogenase
30% identity, 85% coverage: 31:337/363 of query aligns to 40:356/385 of 7y0bA
- binding (2S,3R,4R,5S,6R)-2-[4-chloranyl-3-[[4-[(3S)-oxolan-3-yl]oxyphenyl]methyl]phenyl]-6-(hydroxymethyl)oxane-3,4,5-triol: M343 (= M324), T347 (≠ E328), E348 (= E329)
- binding flavin-adenine dinucleotide: F125 (≠ L114), L127 (≠ W116), S128 (≠ Q117), G133 (≠ R122), S134 (≠ Y123), W158 (≠ V147), T160 (≠ L149), R270 (= R250), F273 (= F253), L280 (≠ F260), V282 (= V262), Q338 (= Q319), I339 (≠ L320), G342 (≠ A323)
Sites not aligning to the query:
P15651 Short-chain specific acyl-CoA dehydrogenase, mitochondrial; SCAD; Butyryl-CoA dehydrogenase; EC 1.3.8.1 from Rattus norvegicus (Rat) (see 2 papers)
30% identity, 85% coverage: 31:337/363 of query aligns to 67:383/412 of P15651
Sites not aligning to the query:
- 1:24 modified: transit peptide, Mitochondrion
- 392 active site, Proton acceptor
- 394:396 binding
P16219 Short-chain specific acyl-CoA dehydrogenase, mitochondrial; SCAD; Butyryl-CoA dehydrogenase; EC 1.3.8.1 from Homo sapiens (Human) (see 3 papers)
30% identity, 85% coverage: 31:337/363 of query aligns to 67:383/412 of P16219
- G90 (= G54) to S: in ACADSD; loss of acyl-CoA dehydrogenase activity; dbSNP:rs121908005
- E104 (≠ A68) natural variant: Missing (in ACADSD; loss of acyl-CoA dehydrogenase activity; dbSNP:rs387906308)
- 152:161 (vs. 114:123, 20% identical) binding in other chain
- R171 (= R133) to W: 69% of wild-type acyl-CoA dehydrogenase activity; confers susceptibility to ethylmalonicaciduria; dbSNP:rs1800556
- WIT 185:187 (≠ VVL 147:149) binding in other chain
- A192 (= A154) to V: in ACADSD; loss of acyl-CoA dehydrogenase activity; dbSNP:rs28940874
- G209 (≠ S167) to S: 86% of wild-type acyl-CoA dehydrogenase activity; confers susceptibility to ethylmalonicaciduria; dbSNP:rs1799958
- R297 (= R250) binding
- Q308 (= Q261) binding in other chain
- R325 (= R278) to W: in ACADSD; loss of acyl-CoA dehydrogenase activity; dbSNP:rs121908006
- S353 (≠ G307) to L: in ACADSD; loss of acyl-CoA dehydrogenase activity; dbSNP:rs28941773
- QILGG 365:369 (≠ QLHGA 319:323) binding
- R380 (≠ H334) to W: in ACADSD; loss of acyl-CoA dehydrogenase activity; dbSNP:rs28940875
Sites not aligning to the query:
- 1:24 modified: transit peptide, Mitochondrion
- 394:396 binding in other chain
2vigB Crystal structure of human short-chain acyl coa dehydrogenase
31% identity, 85% coverage: 31:337/363 of query aligns to 34:343/371 of 2vigB
- active site: L121 (≠ W116), S122 (≠ Q117), G231 (= G224)
- binding coenzyme a persulfide: S128 (≠ Y123), F221 (≠ S214), M225 (≠ E218), Q226 (≠ A219), L228 (= L221), D229 (≠ A222), R232 (= R225)
- binding flavin-adenine dinucleotide: L121 (≠ W116), S122 (≠ Q117), G127 (≠ R122), S128 (≠ Y123), W152 (≠ V147), T154 (≠ L149), R257 (= R250), F260 (= F253), L264 (= L257), L267 (≠ F260), Q325 (= Q319), I326 (≠ L320), G329 (≠ A323)
Sites not aligning to the query:
1ukwB Crystal structure of medium-chain acyl-coa dehydrogenase from thermus thermophilus hb8
30% identity, 100% coverage: 1:363/363 of query aligns to 1:379/379 of 1ukwB
- active site: L124 (≠ W116), S125 (≠ Q117), T241 (≠ G224), E362 (≠ L346), R374 (≠ E358)
- binding cobalt (ii) ion: D145 (= D137), H146 (≠ G138)
- binding flavin-adenine dinucleotide: F122 (≠ L114), L124 (≠ W116), S125 (≠ Q117), G130 (≠ R122), S131 (≠ Y123), W155 (≠ V147), S157 (≠ L149), K200 (≠ L188), L357 (≠ M341), Y361 (≠ H345), E362 (≠ L346), T364 (≠ D348), E366 (≠ D350), L370 (≠ E354)
1ukwA Crystal structure of medium-chain acyl-coa dehydrogenase from thermus thermophilus hb8
30% identity, 100% coverage: 1:363/363 of query aligns to 1:379/379 of 1ukwA
- active site: L124 (≠ W116), S125 (≠ Q117), T241 (≠ G224), E362 (≠ L346), R374 (≠ E358)
- binding flavin-adenine dinucleotide: F122 (≠ L114), L124 (≠ W116), S125 (≠ Q117), G130 (≠ R122), S131 (≠ Y123), W155 (≠ V147), S157 (≠ L149), L357 (≠ M341), Y361 (≠ H345), E362 (≠ L346), T364 (≠ D348), E366 (≠ D350), L370 (≠ E354)
7szvA Crystal structure of acyl-coa dehydrogenase from mycobacterium marinum in complex with fda
27% identity, 98% coverage: 5:360/363 of query aligns to 6:370/372 of 7szvA
- binding dihydroflavine-adenine dinucleotide: L122 (≠ W116), T123 (≠ Q117), F153 (≠ V147), I154 (≠ V148), T155 (≠ L149), K194 (≠ L188), R261 (= R250), S263 (≠ Q252), Y271 (≠ F260), I274 (≠ L263), Q329 (= Q319), V330 (≠ L320), G332 (= G322), G333 (≠ A323), T358 (≠ D348), E360 (≠ D350)
6fahD Molecular basis of the flavin-based electron-bifurcating caffeyl-coa reductase reaction (see paper)
28% identity, 87% coverage: 31:347/363 of query aligns to 37:363/379 of 6fahD
- active site: L124 (≠ W116), T125 (≠ Q117), G241 (= G224)
- binding flavin-adenine dinucleotide: F122 (≠ L114), L124 (≠ W116), T125 (≠ Q117), R152 (≠ T144), F155 (≠ V147), T157 (≠ L149), E198 (≠ D184), R267 (= R250), Q269 (= Q252), F270 (= F253), I274 (≠ L257), F277 (= F260), Q335 (= Q319), I336 (≠ L320), G339 (≠ A323), Y361 (≠ H345)
Sites not aligning to the query:
5ol2F The electron transferring flavoprotein/butyryl-coa dehydrogenase complex from clostridium difficile (see paper)
27% identity, 91% coverage: 31:360/363 of query aligns to 37:376/378 of 5ol2F
- active site: L124 (≠ W116), T125 (≠ Q117), G241 (= G224), G374 (≠ E358)
- binding coenzyme a persulfide: L238 (= L221), R242 (= R225), E362 (≠ L346), G363 (= G347)
- binding flavin-adenine dinucleotide: F122 (≠ L114), L124 (≠ W116), T125 (≠ Q117), P127 (≠ T119), T131 (≠ Y123), F155 (≠ V147), I156 (≠ V148), T157 (≠ L149), E198 (≠ R183), R267 (= R250), F270 (= F253), L274 (= L257), F277 (= F260), Q335 (= Q319), L336 (= L320), G338 (= G322), G339 (≠ A323), Y361 (≠ H345), T364 (≠ D348), E366 (≠ D350)
Sites not aligning to the query:
8i4rA Crystal structure of acyl-coa dehydrogenase complexed with acetyl-coa from thermobifida fusca
30% identity, 80% coverage: 49:337/363 of query aligns to 57:356/381 of 8i4rA
- binding acetyl coenzyme *a: S132 (≠ Y123), T134 (≠ A125), R180 (vs. gap), R234 (≠ E218), L237 (vs. gap), R238 (vs. gap), L240 (= L221), D241 (≠ A222), R244 (= R225)
- binding flavin-adenine dinucleotide: Y123 (≠ L114), L125 (≠ W116), S126 (≠ Q117), G131 (≠ R122), S132 (≠ Y123), W156 (≠ V147), I157 (≠ V148), T158 (≠ L149)
Sites not aligning to the query:
8i4pA Crystal structure of acyl-coa dehydrogenase from thermobifida fusca
30% identity, 80% coverage: 49:337/363 of query aligns to 57:356/381 of 8i4pA
Sites not aligning to the query:
7w0jE Acyl-coa dehydrogenase, tfu_1647
30% identity, 80% coverage: 49:337/363 of query aligns to 58:357/382 of 7w0jE
- binding [[(2R,3S,4R,5R)-5-(6-aminopurin-9-yl)-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl] [(2R,3S,4S)-5-azanyl-2,3,4-tris(oxidanyl)pentyl] hydrogen phosphate: S127 (≠ Q117), W157 (≠ V147), R270 (= R250), Q272 (= Q252), F273 (= F253), I277 (≠ L257), F280 (= F260), I283 (≠ L263), Q339 (= Q319), L340 (= L320), G343 (≠ A323)
Sites not aligning to the query:
- binding [[(2R,3S,4R,5R)-5-(6-aminopurin-9-yl)-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl] [(2R,3S,4S)-5-azanyl-2,3,4-tris(oxidanyl)pentyl] hydrogen phosphate: 365, 366, 368, 370, 371
4n5fA Crystal structure of a putative acyl-coa dehydrogenase with bound fadh2 from burkholderia cenocepacia j2315
28% identity, 93% coverage: 1:337/363 of query aligns to 2:355/378 of 4n5fA
Sites not aligning to the query:
2dvlA Crystal structure of project tt0160 from thermus thermophilus hb8
31% identity, 91% coverage: 6:337/363 of query aligns to 2:345/370 of 2dvlA
Sites not aligning to the query:
1rx0A Crystal structure of isobutyryl-coa dehydrogenase complexed with substrate/ligand. (see paper)
27% identity, 85% coverage: 31:337/363 of query aligns to 43:358/384 of 1rx0A
- active site: L129 (≠ W116), T130 (≠ Q117), G245 (= G224)
- binding flavin-adenine dinucleotide: Y127 (≠ L114), L129 (≠ W116), T130 (≠ Q117), G135 (≠ R122), S136 (≠ Y123), F160 (≠ V147), I161 (≠ V148), S162 (≠ L149), W207 (≠ L188), R271 (= R250), F274 (= F253), L278 (= L257), N281 (≠ F260), L284 (= L263), Q340 (= Q319), M341 (≠ L320), G343 (= G322), G344 (≠ A323), Y345 (≠ M324)
Sites not aligning to the query:
1rx0C Crystal structure of isobutyryl-coa dehydrogenase complexed with substrate/ligand. (see paper)
27% identity, 85% coverage: 31:337/363 of query aligns to 42:357/383 of 1rx0C
- active site: L128 (≠ W116), T129 (≠ Q117), G244 (= G224)
- binding methacrylyl-coenzyme a: I93 (≠ G81), Y126 (≠ L114), S135 (≠ Y123), V238 (≠ T220), L241 (= L221), N242 (≠ A222), R245 (= R225), V316 (≠ D296)
- binding flavin-adenine dinucleotide: Y126 (≠ L114), L128 (≠ W116), T129 (≠ Q117), G134 (≠ R122), S135 (≠ Y123), F159 (≠ V147), I160 (≠ V148), S161 (≠ L149), R270 (= R250), F273 (= F253), N280 (≠ F260), L283 (= L263), Q339 (= Q319), M340 (≠ L320), G342 (= G322), G343 (≠ A323), Y344 (≠ M324)
Sites not aligning to the query:
Q9UKU7 Isobutyryl-CoA dehydrogenase, mitochondrial; IBDH; Activator-recruited cofactor 42 kDa component; ARC42; Acyl-CoA dehydrogenase family member 8; ACAD-8; EC 1.3.8.5 from Homo sapiens (Human) (see 3 papers)
27% identity, 85% coverage: 31:337/363 of query aligns to 74:389/415 of Q9UKU7
- G137 (≠ A93) to R: in IBDD; loss of protein solubility; complete loss of isobutyryl-CoA dehydrogenase activity; dbSNP:rs371449613
- 158:167 (vs. 114:123, 20% identical) binding in other chain
- S167 (≠ Y123) binding
- FIS 191:193 (≠ VVL 147:149) binding in other chain
- NGGR 274:277 (≠ AQGR 222:225) binding
- R302 (= R250) binding ; to Q: in IBDD; no effect on localization to the mitochondrion; complete loss of isobutyryl-CoA dehydrogenase activity; loss of protein expression in patient cells; dbSNP:rs121908422
- NQ 312:313 (≠ FQ 260:261) binding
- A320 (≠ V268) to T: in IBDD; decreased isobutyryl-CoA dehydrogenase activity; less than 20% of wild-type; dbSNP:rs200620279
- QMHGG 371:375 (≠ QLHGA 319:323) binding
Sites not aligning to the query:
- 400:402 binding in other chain
- 410 binding
Query Sequence
>WP_086509768.1 NCBI__GCF_002151265.1:WP_086509768.1
MDFSYSDEQRMLADTLERLVADARAGSPTAPASLWRTFAELGLLQLPFAEELGGLDGDGI
DVMIVMQALGRGLLRAPYLGGLLLPGTLLARLANSAQRERWLSPLLAGESRLALAWQETA
SRYDAQAIATRARRQADGWVLDGTKQVVLAAASADALVVTARLDDGSLAVFLVPSDSTGL
VRRDYATLDDQTASDVQLDGVALPHDARLGGDASDALEATLAQGRAALCAEAVGAMQVSC
ELTLAYLKERQQFGAPLASFQVLQHRMVDMHLNLEQARSMAILVAASLERPAEQRDYRVS
AAKAYCGEAARFVAEQAIQLHGAMGMTEECQVSHYARRLIMFDHHLGDVDHHLEIVSERL
TAA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory