Comparing WP_086509854.1 NCBI__GCF_002151265.1:WP_086509854.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 4 hits to proteins with known functional sites (download)
O31645 PTS system mannose-specific EIIBCA component; EIIBCA-Man; EII-Man; EC 2.7.1.191 from Bacillus subtilis (strain 168) (see 2 papers)
25% identity, 92% coverage: 3:146/156 of query aligns to 502:646/650 of O31645
Sites not aligning to the query:
P46321 Probable licABCH operon regulator; EC 2.7.1.- from Bacillus subtilis (strain 168) (see paper)
28% identity, 88% coverage: 7:144/156 of query aligns to 501:633/641 of P46321
Sites not aligning to the query:
O31644 Transcriptional regulator ManR; Mannose operon transcriptional activator; EC 2.7.1.191 from Bacillus subtilis (strain 168) (see paper)
35% identity, 46% coverage: 51:121/156 of query aligns to 554:621/648 of O31644
Sites not aligning to the query:
C0H3V2 Mannitol-specific phosphotransferase enzyme IIA component; EIIA; EIII; PTS system mannitol-specific EIIA component from Bacillus subtilis (strain 168) (see paper)
25% identity, 65% coverage: 41:142/156 of query aligns to 36:135/143 of C0H3V2
>WP_086509854.1 NCBI__GCF_002151265.1:WP_086509854.1
MTLENILPPERALFDVPGGSKKRVLEFFSTFIAQNTPSLDSQEVFGRLIGRERLGSTGIG
NGVAIPHARSPHCHSPVAAFLKLAEPIDFDAIDGEPVDLVFVLLVPEEADDTHLSLLSQV
ASVMNDAETRSQLRKCESQRELHERLIDAIRRQSSA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory