SitesBLAST
Comparing WP_086509880.1 NCBI__GCF_002151265.1:WP_086509880.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 18 hits to proteins with known functional sites (download)
5i39A High resolution structure of l-amino acid deaminase from proteus vulgaris with the deletion of the specific insertion sequence (see paper)
24% identity, 85% coverage: 33:397/431 of query aligns to 23:374/383 of 5i39A
- active site: F66 (≠ S76), Q69 (= Q79), A70 (≠ I80), Q248 (≠ E272), P267 (≠ D293)
- binding flavin-adenine dinucleotide: V30 (= V40), G31 (= G41), G33 (= G43), I34 (= I44), L35 (≠ T45), V53 (≠ L63), E54 (= E64), K55 (≠ A65), Q62 (≠ A72), S63 (= S73), F66 (≠ S76), Y67 (≠ G77), Q69 (= Q79), A196 (≠ P214), A197 (= A215), G226 (≠ A242), G227 (≠ N243), W229 (≠ Y245), Q248 (≠ E272), Q250 (≠ R274), G321 (= G345), M323 (≠ V347), T348 (≠ S371), G349 (= G372), W350 (≠ H373), G351 (= G374), M352 (= M375), T353 (≠ A376)
7cyxA Crystal strcuture of glycine oxidase from bacillus cereus atcc 14579 (see paper)
22% identity, 86% coverage: 34:405/431 of query aligns to 1:360/363 of 7cyxA
- binding flavin-adenine dinucleotide: I7 (≠ V40), G8 (= G41), G10 (= G43), V11 (≠ I44), I12 (≠ T45), V30 (≠ L63), E31 (= E64), K32 (≠ A65), E38 (≠ G71), A39 (= A72), S40 (= S73), A43 (≠ S76), G45 (= G78), L46 (= L81), V171 (≠ A215), G200 (≠ A242), G201 (≠ N243), W203 (≠ Y245), G298 (= G345), R300 (≠ V347), P301 (≠ A348), Y326 (≠ S371), R327 (≠ G372), N328 (≠ H373), G329 (= G374), I330 (≠ M375)
5hxwA L-amino acid deaminase from proteus vulgaris (see paper)
27% identity, 55% coverage: 33:269/431 of query aligns to 15:237/433 of 5hxwA
- active site: F58 (≠ S76), Q61 (= Q79), A62 (≠ I80)
- binding flavin-adenine dinucleotide: V22 (= V40), G23 (= G41), G25 (= G43), I26 (= I44), L27 (≠ T45), E46 (= E64), K47 (≠ A65), E53 (≠ G71), Q54 (≠ A72), S55 (= S73), R57 (= R75), F58 (≠ S76), Y59 (≠ G77), G60 (= G78), Q61 (= Q79), A188 (≠ P214), A189 (= A215), G218 (≠ A242), G219 (≠ N243), W221 (≠ Y245)
Sites not aligning to the query:
- active site: 240, 284, 288
- binding cetyl-trimethyl-ammonium: 291, 294, 310, 311, 317, 318, 320, 373, 379, 399, 400
- binding flavin-adenine dinucleotide: 240, 242, 331, 371, 373, 398, 399, 400, 401, 402, 403
Q63342 Dimethylglycine dehydrogenase, mitochondrial; ME2GLYDH; EC 1.5.8.4 from Rattus norvegicus (Rat) (see 2 papers)
23% identity, 90% coverage: 17:405/431 of query aligns to 23:424/857 of Q63342
- CV 52:53 (≠ IT 44:45) binding
- EK 73:74 (≠ EA 64:65) binding
- 80:88 (vs. 71:79, 22% identical) binding
- H84 (≠ R75) modified: Tele-8alpha-FAD histidine
- V212 (≠ A215) binding
- W244 (≠ Y245) binding
- FGYGII 390:395 (≠ SGHGMA 371:376) binding
Sites not aligning to the query:
- 573:575 binding
- 669 binding
- 676:678 binding
- 737 binding
Q8GAI3 4-methylaminobutanoate oxidase (formaldehyde-forming); MABO; Demethylating gamma-N-methylaminobutyrate oxidase; Gamma-N-methylaminobutyrate oxidase 1; EC 1.5.3.19 from Paenarthrobacter nicotinovorans (Arthrobacter nicotinovorans) (see paper)
25% identity, 89% coverage: 35:417/431 of query aligns to 26:410/824 of Q8GAI3
- W66 (≠ G74) mutation W->F,S: Contains a non-covalently bound FAD. Loss of enzyme activity.
- H67 (≠ R75) mutation to A: Contains a non-covalently bound FAD. Exhibits about 10% of the wild-type enzyme activity.
S5FMM4 Glycine oxidase; GO; BliGO; EC 1.4.3.19 from Bacillus licheniformis (see paper)
24% identity, 86% coverage: 33:401/431 of query aligns to 3:361/369 of S5FMM4
- G51 (≠ L81) mutation to S: Shows 4.3- and 107-fold increase of affinity to glyphosate and glycine, respectively. Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with R-54, R-81, C-202, V-332 and V-342.
- A54 (≠ L84) mutation to R: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-81, C-202, V-332 and V-342.
- K81 (≠ V111) mutation to R: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-54, C-202, V-332 and V-342.
- S202 (≠ A242) mutation to C: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-54, R-81, V-332 and V-342.
- I332 (≠ M375) mutation to V: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-54, R-81, C-202 and V-342.
- M342 (≠ L385) mutation to V: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-54, R-81, C-202 and V-332.
5fjnA Structure of l-amino acid deaminase from proteus myxofaciens in complex with anthranilate (see paper)
23% identity, 84% coverage: 36:397/431 of query aligns to 30:436/447 of 5fjnA
- active site: S67 (= S73), Y71 (≠ G77), S72 (≠ G78), L252 (≠ I257)
- binding 2-aminobenzoic acid: L252 (≠ I257), R289 (vs. gap), V411 (≠ G369), W412 (≠ Y370)
- binding flavin-adenine dinucleotide: I34 (≠ V40), G35 (= G41), G37 (= G43), I38 (= I44), Q39 (≠ T45), L57 (= L63), E58 (= E64), K59 (≠ A65), E65 (≠ G71), Q66 (≠ A72), S67 (= S73), A70 (≠ S76), Y71 (≠ G77), S72 (≠ G78), Q73 (= Q79), V201 (≠ A215), G230 (= G241), G231 (vs. gap), W233 (vs. gap), L252 (≠ I257), Q254 (≠ R259), F343 (≠ R317), V385 (= V347), T410 (≠ Q368), V411 (≠ G369), W412 (≠ Y370), G413 (= G374), M414 (= M375), T415 (≠ A376)
5fjmA Structure of l-amino acid deaminase from proteus myxofaciens (see paper)
23% identity, 84% coverage: 36:397/431 of query aligns to 30:436/447 of 5fjmA
- active site: S67 (= S73), Y71 (≠ G77), S72 (≠ G78), L252 (≠ I257)
- binding flavin-adenine dinucleotide: I34 (≠ V40), G35 (= G41), G37 (= G43), I38 (= I44), Q39 (≠ T45), L57 (= L63), E58 (= E64), K59 (≠ A65), E65 (≠ G71), Q66 (≠ A72), S67 (= S73), A70 (≠ S76), Y71 (≠ G77), S72 (≠ G78), Q73 (= Q79), V201 (≠ A215), G230 (= G241), G231 (vs. gap), W233 (vs. gap), L252 (≠ I257), Q254 (≠ R259), F343 (≠ R317), V385 (= V347), T410 (≠ Q368), V411 (≠ G369), W412 (≠ Y370), G413 (= G374), M414 (= M375), T415 (≠ A376)
4pabB Crystal structure of the precursor form of rat dmgdh complexed with tetrahydrofolate (see paper)
23% identity, 86% coverage: 34:405/431 of query aligns to 5:387/824 of 4pabB
- active site: T53 (≠ L81), E102 (= E143), H226 (≠ N262), Y255 (= Y295)
- binding flavin-adenine dinucleotide: I11 (≠ V40), G12 (= G41), G14 (= G43), C15 (≠ I44), V16 (≠ T45), L35 (= L63), E36 (= E64), K37 (≠ A65), G43 (= G71), S44 (≠ A72), T45 (≠ S73), H47 (≠ R75), A48 (≠ S76), A49 (≠ G77), G50 (= G78), L51 (≠ Q79), V175 (≠ A215), A204 (= A242), G205 (≠ N243), W207 (≠ Y245), H226 (≠ N262), Y228 (≠ I264), G326 (= G345), I328 (≠ V347), F353 (≠ S371), Y355 (≠ H373), G356 (= G374), I357 (≠ M375), I358 (≠ A376)
Sites not aligning to the query:
- active site: 536
- binding (6s)-5,6,7,8-tetrahydrofolate: 523, 536, 538, 550, 612, 613, 632, 639, 680, 700
2gagB Heteroteterameric sarcosine: structure of a diflavin metaloenzyme at 1.85 a resolution (see paper)
25% identity, 88% coverage: 36:413/431 of query aligns to 21:393/403 of 2gagB
- active site: A61 (≠ G74), T64 (≠ G77), T65 (≠ G78)
- binding flavin-adenine dinucleotide: G26 (= G41), G28 (= G43), G29 (≠ I44), H30 (≠ T45), E51 (= E64), K52 (≠ A65), G58 (= G71), N59 (≠ A72), M60 (≠ S73), R62 (= R75), N63 (≠ S76), T64 (≠ G77), I66 (≠ Q79), V195 (≠ A215), G224 (≠ N243), A225 (= A244), H227 (≠ L246), L231 (= L250), L246 (= L270), G352 (≠ S371), T353 (≠ G372), G354 (≠ H373), G355 (= G374), F356 (≠ M375), K357 (≠ A376)
- binding flavin mononucleotide: A61 (≠ G74), R62 (= R75), H171 (≠ P191), V250 (≠ R274), E278 (≠ R302), R321 (≠ Y341), W323 (= W343)
- binding 2-furoic acid: T64 (≠ G77), I66 (≠ Q79), R68 (≠ L81), M263 (≠ D287), Y270 (= Y294), K357 (≠ A376)
- binding sulfite ion: K170 (≠ H190), K276 (≠ D300)
Sites not aligning to the query:
3if9A Crystal structure of glycine oxidase g51s/a54r/h244a mutant in complex with inhibitor glycolate (see paper)
22% identity, 81% coverage: 52:402/431 of query aligns to 22:359/364 of 3if9A
- active site: A47 (≠ G77), G48 (= G78), M49 (≠ Q79)
- binding flavin-adenine dinucleotide: E34 (= E64), S35 (≠ A65), T42 (≠ A72), T43 (≠ S73), A46 (≠ S76), A47 (≠ G77), G48 (= G78), M49 (≠ Q79), P173 (= P214), V174 (≠ A215), S202 (≠ A242), G203 (≠ N243), W205 (≠ Y245), F209 (≠ L249), G300 (= G345), R302 (≠ V347), H327 (≠ Y370), F328 (≠ S371), R329 (≠ G372), N330 (≠ H373), G331 (= G374), I332 (≠ M375)
- binding glycolic acid: Y246 (≠ F290), R302 (≠ V347), R329 (≠ G372)
Sites not aligning to the query:
1ng3A Complex of thio (glycine oxidase) with acetyl-glycine (see paper)
23% identity, 81% coverage: 52:402/431 of query aligns to 22:359/364 of 1ng3A
- active site: A47 (≠ L81), G48 (≠ P82), M49 (≠ G83)
- binding acetylamino-acetic acid: Y246 (≠ R296), R302 (≠ V347), R329 (≠ G372)
- binding flavin-adenine dinucleotide: F33 (≠ L63), E34 (= E64), S35 (≠ A65), R41 (= R75), T42 (≠ S76), T43 (≠ G77), A46 (≠ I80), A47 (≠ L81), G48 (≠ P82), M49 (≠ G83), V174 (≠ A215), S202 (≠ A242), G203 (≠ N243), W205 (≠ Y245), F209 (≠ L249), G300 (= G345), R302 (≠ V347), H327 (≠ Y370), R329 (≠ G372), N330 (≠ H373), G331 (= G374), I332 (≠ M375)
- binding phosphate ion: R89 (≠ E119), R254 (= R302)
Sites not aligning to the query:
O31616 Glycine oxidase; GO; EC 1.4.3.19 from Bacillus subtilis (strain 168) (see 3 papers)
23% identity, 81% coverage: 52:402/431 of query aligns to 22:359/369 of O31616
- ES 34:35 (≠ EA 64:65) binding
- TT 42:43 (≠ SG 76:77) binding
- AGM 47:49 (≠ LPG 81:83) binding
- G51 (= G85) mutation to R: 130-fold decrease in catalytic efficiency on glycine and 28-fold increase in that on glyphosate.; mutation to S: 60-fold decrease in catalytic efficiency on glycine and 210-fold increase in that on glyphosate; when associated with R-54 and A-244.
- A54 (≠ I88) mutation to R: 20-fold decrease in catalytic efficiency on glycine and 34-fold increase in that on glyphosate. 60-fold decrease in catalytic efficiency on glycine and 210-fold increase in that on glyphosate; when associated with S-51 and A-244.
- V174 (≠ A215) binding
- H244 (≠ Y294) mutation to A: 2-fold decrease in catalytic efficiency on glycine and similar catalytic efficiency on glyphosate. 60-fold decrease in catalytic efficiency on glycine and 210-fold increase in that on glyphosate; when associated with S-51 and R-54.
- R302 (≠ V347) binding
- 327:333 (vs. 370:376, 14% identical) binding
- R329 (≠ G372) binding
Sites not aligning to the query:
Q50LF2 Sarcosine oxidase subunit beta; Sarcosine oxidase subunit B; Sarcosine oxidase (5,10-methylenetetrahydrofolate-forming) subunit beta; Tetrameric sarcosine oxidase subunit beta; TSOX subunit beta; EC 1.5.3.24 from Corynebacterium sp. (strain U-96) (see 4 papers)
25% identity, 58% coverage: 162:413/431 of query aligns to 136:395/405 of Q50LF2
- K172 (≠ H190) mutation to A: Retains 39% of wild-type activity.; mutation to D: Retains 32% of wild-type activity.; mutation to R: Retains 58% of wild-type activity.
- H173 (≠ P191) modified: Tele-8alpha-FMN histidine
- V197 (≠ A215) binding
- H270 (≠ L292) mutation to A: 10-fold decrease in catalytic efficiency.
- Y272 (= Y294) mutation to A: 13000-fold decrease in catalytic efficiency.; mutation to F: 130-fold decrease in catalytic efficiency.
- G354 (≠ S371) binding
- G357 (= G374) binding
- K359 (≠ A376) binding ; mutation K->A,D: Loss of activity.; mutation to R: Retains 0.07% of wild-type activity. Shows higher apparent KM for sarcosine.
Sites not aligning to the query:
- 31 binding
- 32 binding
- 53 binding
- 61 binding
- 62 binding
- 66 binding
- 68 binding
3ad8B Heterotetrameric sarcosine oxidase from corynebacterium sp. U-96 in complex with pyrrole 2-carboxylate (see paper)
25% identity, 58% coverage: 162:413/431 of query aligns to 135:394/404 of 3ad8B
- active site: G326 (= G345), K358 (≠ A376)
- binding flavin-adenine dinucleotide: V196 (≠ A215), G225 (≠ N243), A226 (= A244), H228 (≠ L246), L247 (= L270), G353 (≠ S371), T354 (≠ G372), G355 (≠ H373), G356 (= G374), F357 (≠ M375), K358 (≠ A376)
- binding flavin mononucleotide: H172 (≠ P191), V251 (≠ R274), E279 (≠ R302), R322 (≠ Y341), W324 (= W343)
- binding pyrrole-2-carboxylate: M264 (≠ D287), Y271 (= Y294), T354 (≠ G372), K358 (≠ A376)
Sites not aligning to the query:
- active site: 62, 65, 66
- binding flavin-adenine dinucleotide: 26, 27, 29, 30, 31, 52, 53, 59, 60, 61, 63, 64, 65, 67
- binding flavin mononucleotide: 62, 63
- binding pyrrole-2-carboxylate: 65, 67, 69, 402
3ad7B Heterotetrameric sarcosine oxidase from corynebacterium sp. U-96 in complex with methylthio acetate (see paper)
25% identity, 58% coverage: 162:413/431 of query aligns to 135:394/404 of 3ad7B
- active site: G326 (= G345), K358 (≠ A376)
- binding flavin-adenine dinucleotide: V196 (≠ A215), G225 (≠ N243), A226 (= A244), H228 (≠ L246), L247 (= L270), G353 (≠ S371), T354 (≠ G372), G355 (≠ H373), G356 (= G374), F357 (≠ M375), K358 (≠ A376)
- binding flavin mononucleotide: H172 (≠ P191), V251 (≠ R274), K277 (≠ D300), E279 (≠ R302), R322 (≠ Y341), W324 (= W343)
- binding [methylthio]acetate: M264 (≠ D287), Y271 (= Y294), T354 (≠ G372), K358 (≠ A376)
Sites not aligning to the query:
- active site: 62, 65, 66
- binding flavin-adenine dinucleotide: 26, 27, 29, 30, 31, 52, 53, 59, 60, 61, 63, 64, 65, 67
- binding flavin mononucleotide: 62, 63
- binding [methylthio]acetate: 67, 69, 402
1vrqB Crystal structure of heterotetrameric sarcosine oxidase from corynebacterium sp. U-96 in complex with folinic acid (see paper)
25% identity, 58% coverage: 162:413/431 of query aligns to 135:394/402 of 1vrqB
- active site: G326 (= G345), K358 (≠ A376)
- binding n,n-dimethylglycine: K358 (≠ A376)
- binding flavin-adenine dinucleotide: V196 (≠ A215), A224 (= A242), G225 (≠ N243), H228 (≠ L246), L247 (= L270), G353 (≠ S371), T354 (≠ G372), G355 (≠ H373), G356 (= G374), F357 (≠ M375), K358 (≠ A376)
- binding flavin mononucleotide: H172 (≠ P191), V251 (≠ R274), E279 (≠ R302), R322 (≠ Y341), W324 (= W343)
Sites not aligning to the query:
- active site: 62, 65, 66
- binding n,n-dimethylglycine: 65, 67, 69, 401
- binding flavin-adenine dinucleotide: 26, 27, 29, 30, 31, 51, 52, 53, 59, 60, 61, 63, 64, 65, 67
- binding flavin mononucleotide: 62, 63
P40875 Sarcosine oxidase subunit beta; Sarcosine oxidase subunit B; Sarcosine oxidase (5,10-methylenetetrahydrofolate-forming) subunit beta; Tetrameric sarcosine oxidase subunit beta; TSOX subunit beta; EC 1.5.3.24 from Corynebacterium sp. (strain P-1) (see 3 papers)
26% identity, 58% coverage: 162:413/431 of query aligns to 136:395/405 of P40875
- C146 (vs. gap) mutation to S: No change in activity.
- H173 (≠ P191) modified: Tele-8alpha-FMN histidine; mutation to N: Prevents covalent attachment of FMN. Loss of activity. The mutant is considerably less stable than wild-type enzyme, the beta and delta subunits are lost during purification, which yields a stable alpha-gamma complex.
- H175 (≠ N193) mutation to A: No effect on FMN binding and activity.
- C195 (≠ S213) mutation to S: No change in activity.
- C351 (≠ Q368) mutation to A: No change in activity.
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 30 G→A: Prevents covalent attachment of FMN. Blocks subunit assembly.
Query Sequence
>WP_086509880.1 NCBI__GCF_002151265.1:WP_086509880.1
MADAAQFASPASYYRDSVAVRLDRACPPQRGHQRVDVCVVGGGITGCSAALHLAERGYSV
ALLEAHEIGFGASGRSGGQILPGLGTDIATVEQALGRERARQVWEMSREAVRLTAELIER
HAIPCDLAWGYLHAAVKPRHVRELRQFQERMARDYGYEALAWLEGEALRERVVTDAYPGA
LFDSEGGHLHPLNYTLGLARAAQQAGVAIHEHSPALDVRRGQPATVVTERGEITADFVVV
GANAYLGRLLPELDGHIMRAANYIVATEPLGEARASQVLPYNDAISDANFVLDYYRLSAD
KRLIYGGEVSYDGREPRGLQRRMDAKIARLFPLLEGVRIDYRWGGDVAITLNRAPDFGRL
GANVYYAQGYSGHGMALAGLAGKLLAEAIAGQSEGFDLFAAMPHRRFPGGERLRTPLLVL
ATTFYKLRDRL
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory