Comparing WP_086509908.1 NCBI__GCF_002151265.1:WP_086509908.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6umfA Crystal structure of human gac in complex with inhibitor upgl00012
36% identity, 84% coverage: 40:300/310 of query aligns to 123:385/409 of 6umfA
6uljA Crystal structure of human gac in complex with inhibitor upgl00012
36% identity, 84% coverage: 40:300/310 of query aligns to 123:385/409 of 6uljA
6ulaA Crystal structure of human gac in complex with inhibitor upgl00012
36% identity, 84% coverage: 40:300/310 of query aligns to 123:385/409 of 6ulaA
6ukbA Crystal structure of human gac in complex with inhibitor upgl00012
36% identity, 84% coverage: 40:300/310 of query aligns to 123:385/409 of 6ukbA
6ujmA Crystal structure of human gac in complex with inhibitor upgl00013
36% identity, 84% coverage: 40:300/310 of query aligns to 123:385/409 of 6ujmA
6uk6A Crystal structure of human gac in complex with inhibitor upgl00018
36% identity, 84% coverage: 40:300/310 of query aligns to 118:380/404 of 6uk6A
6umcB Crystal structure of human gac in complex with inhibitor upgl00012
36% identity, 84% coverage: 40:300/310 of query aligns to 123:385/410 of 6umcB
6ujgA Crystal structure of human gac in complex with inhibitor upgl00012
36% identity, 84% coverage: 40:300/310 of query aligns to 123:385/410 of 6ujgA
5wj6A Crystal structure of glutaminasE C in complex with inhibitor 2-phenyl- n-{5-[4-({5-[(phenylacetyl)amino]-1,3,4-thiadiazol-2-yl}amino) piperidin-1-yl]-1,3,4-thiadiazol-2-yl}acetamide (upgl-00004) (see paper)
36% identity, 84% coverage: 40:300/310 of query aligns to 123:385/410 of 5wj6A
5i94A Crystal structure of human glutaminasE C in complex with the inhibitor upgl-00019 (see paper)
36% identity, 84% coverage: 40:300/310 of query aligns to 123:385/410 of 5i94A
4o7dA Crystal structure of human glutaminase in complex don (see paper)
36% identity, 84% coverage: 40:300/310 of query aligns to 41:303/313 of 4o7dA
Sites not aligning to the query:
8bsnA Human gls in complex with compound 27 (see paper)
36% identity, 84% coverage: 40:300/310 of query aligns to 38:300/311 of 8bsnA
5uqeD Multidomain structure of human kidney-type glutaminase(kga/gls) (see paper)
36% identity, 84% coverage: 40:300/310 of query aligns to 123:385/507 of 5uqeD
5hl1A Crystal structure of glutaminasE C in complex with inhibitor cb-839
36% identity, 84% coverage: 40:300/310 of query aligns to 117:379/404 of 5hl1A
6loxA Crystal structure of human glutaminase with macrocyclic inhibitor (see paper)
36% identity, 84% coverage: 40:300/310 of query aligns to 121:383/407 of 6loxA
8gwrB Near full length kidney type glutaminase in complex with 2,2-dimethyl- 2,3-dihydrobenzo[a] phenanthridin-4(1h)-one (ddp) (see paper)
36% identity, 84% coverage: 40:300/310 of query aligns to 116:378/501 of 8gwrB
6umdB Crystal structure of human gac in complex with inhibitor upgl00012
36% identity, 84% coverage: 40:300/310 of query aligns to 123:385/409 of 6umdB
6ul9B Crystal structure of human gac in complex with inhibitor upgl00023
36% identity, 84% coverage: 40:300/310 of query aligns to 123:385/409 of 6ul9B
8jueA Crystal structure of glutaminasE C in complex with compound 11 (see paper)
36% identity, 84% coverage: 40:300/310 of query aligns to 116:378/401 of 8jueA
8jubA Crystal structure of glutaminasE C in complex with compound 27 (see paper)
36% identity, 84% coverage: 40:300/310 of query aligns to 115:377/401 of 8jubA
>WP_086509908.1 NCBI__GCF_002151265.1:WP_086509908.1
MERIDKAKVAFLQEVVEQEREYRHESEMASFGESGEEDQELVGIALMGAESDVAQAGSAE
QRFPLESVSKALTLALALEDVGAEALFARVGMEPSGDPYHSIATLEEGEMGIPSNPMINA
GAIVTTAMIRGRDGKDRFERLRDFFRRLSANPELDYNRAMFEAEDQDLNRALFYYMRSHD
VLVGSEEDLLVPYLKQTSIEMNCRELSRIAAVLANRGCDPVSGERLIGEETVRIVLTLMF
TTGMYDQSGRYAVEVGMPSKSGVSGAILAVAPGRLGCGVIGPALNEHGNSVAGLRLLEAL
SNRWRLGVFA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory