Comparing WP_086510079.1 NCBI__GCF_002151265.1:WP_086510079.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5kr6B Directed evolution of transaminases by ancestral reconstruction. Using old proteins for new chemistries
74% identity, 96% coverage: 7:461/474 of query aligns to 8:460/460 of 5kr6B
5kr3A Directed evolution of transaminases by ancestral reconstruction. Using old proteins for new chemistries
67% identity, 97% coverage: 3:462/474 of query aligns to 3:458/458 of 5kr3A
5kquC Directed evolution of transaminases by ancestral reconstruction. Using old proteins for new chemistries
67% identity, 96% coverage: 8:462/474 of query aligns to 7:459/459 of 5kquC
5kr5A Directed evolution of transaminases by ancestral reconstruction. Using old proteins for new chemistries
66% identity, 95% coverage: 8:459/474 of query aligns to 5:454/455 of 5kr5A
3gjuA Crystal structure of a putative aminotransferase (mll7127) from mesorhizobium loti maff303099 at 1.55 a resolution
61% identity, 96% coverage: 1:457/474 of query aligns to 2:456/458 of 3gjuA
3fcrA Crystal structure of putative aminotransferase (yp_614685.1) from silicibacter sp. Tm1040 at 1.80 a resolution
60% identity, 96% coverage: 4:457/474 of query aligns to 4:456/458 of 3fcrA
5ghgB Transaminase w58l with smba
43% identity, 96% coverage: 11:463/474 of query aligns to 7:433/433 of 5ghgB
6g4dB Crystal structure of the omega transaminase from pseudomonas jessenii in complex with plp (see paper)
43% identity, 96% coverage: 7:459/474 of query aligns to 2:447/453 of 6g4dB
6g4fA Crystal structure of the omega transaminase from pseudomonas jessenii in complex with pmp (see paper)
43% identity, 96% coverage: 7:459/474 of query aligns to 2:447/451 of 6g4fA
6g4eA Crystal structure of the omega transaminase from pseudomonas jessenii in complex with plp and 6-aminohexanoate (6-aca) (see paper)
43% identity, 96% coverage: 7:459/474 of query aligns to 2:447/451 of 6g4eA
6gwiB The crystal structure of halomonas elongata amino-transferase (see paper)
43% identity, 97% coverage: 4:462/474 of query aligns to 2:450/450 of 6gwiB
7qx3A Structure of the transaminase tr2e2 with eos (see paper)
44% identity, 89% coverage: 34:457/474 of query aligns to 2:417/422 of 7qx3A
Q94CE5 Gamma-aminobutyrate transaminase POP2, mitochondrial; AtGABA-T; Gamma-aminobutyric acid aminotransferase 1; Protein HEXENAL RESPONSE 1; Protein POLLEN-PISTIL INCOMPATIBILITY 2; AtPOP2; EC 2.6.1.96 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
39% identity, 91% coverage: 35:464/474 of query aligns to 72:497/504 of Q94CE5
7ypmA Crystal structure of transaminase cc1012 complexed with plp and l- alanine (see paper)
44% identity, 89% coverage: 34:456/474 of query aligns to 31:446/454 of 7ypmA
7ypnD Crystal structure of transaminase cc1012 mutant m9 complexed with plp (see paper)
44% identity, 89% coverage: 34:456/474 of query aligns to 31:446/455 of 7ypnD
7qx0B Transaminase structure of plurienzyme (tr2e2) in complex with plp (see paper)
44% identity, 89% coverage: 34:457/474 of query aligns to 29:438/443 of 7qx0B
D6R3B6 Vanillin aminotransferase; Putative aminotransferase; pAMT; EC 2.6.1.119 from Capsicum frutescens (Cayenne pepper) (Tabasco pepper) (see paper)
40% identity, 92% coverage: 28:464/474 of query aligns to 22:453/459 of D6R3B6
7q9xAAA Probable aminotransferase
42% identity, 95% coverage: 19:466/474 of query aligns to 11:454/455 of 7q9xAAA
4a6tC Crystal structure of the omega transaminase from chromobacterium violaceum in complex with plp (see paper)
42% identity, 95% coverage: 19:466/474 of query aligns to 11:454/455 of 4a6tC
6s4gA Crystal structure of the omega transaminase from chromobacterium violaceum in complex with pmp (see paper)
42% identity, 95% coverage: 19:466/474 of query aligns to 10:453/453 of 6s4gA
>WP_086510079.1 NCBI__GCF_002151265.1:WP_086510079.1
MNQQHRDLIERDRKVTFHASTHLRDFAHGDAPGRVITGGKGIHIVDKDGREFIDGFAGLY
CVNIGYGRTEVAEAIYQQALELSYYHTYVGHSNEPQIALSEKIIALAGPGMSKVYYGLGG
SDANETQLKIVRYYNNVLGRPQKKKVISRQRGYHGSGLATGSLTGLKAFHDQFDLPLAGI
LHTEAPYYYHRAAEQEGMSEREFSQFCAQKLEEMILAEGPDTVAAFIGEPVLGTGGIVPP
PEGYWEAIQAVLAKYDVLLIADEVVCGFGRIGADFGSHHYGIKPDLITVAKGLTSAYQPL
SGVIVGDRVWSVLEQGTGQYGPIGHGWTYSGHALGCAAALANLAIIEREGLTRNAAETGA
YLQQRMQAAFGEHPIVGNVRGVGMLAALEFSVDPARRAHFDAAHKVGPRIAAAALDENLI
ARAMPQGDILGFAPPLVATPAEIDEIVARAERAVNKVTDQLVREGVVKAAMSVS
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory